CAZyme Information: An02g12450-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An02g12450-T-p1
• CAZy Family: AA7
• CAZyme Description: Putative exopolygalacturonase/exoxylogalacturonan hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		45106.41	6.1298

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An02_A_niger_CBS_513_88:3016104-3017427(-)

Full Sequence      

MSVFKASFLFLLSSSLVHGVPHSSRASRSQQCVVPPLHNARLTRVIIFEEGVNYNIFQPI
TATNLSNVEIRMHGNLHLPQNITAVQNIVSDGTSTWFTLEGPKVDWIGPEDVNNGWIDSY
GQPWWDANPAGSSGIDNRPHLMSFKSSQATMKYFRSRKPIAWNVKLHGQDITVSHAIIDA
TSTGSFPFNTDGFDVEGTNIQITDSIMYNGDDAIAKHHRLPDSRHEHGSLGKDPTDFANI
SNIRFDDVTVVDGLYAARFKSWSGGTGLVKNVTWNNIRVFNVTFPIFVTQSYSDQGASRS
GTVNASSAVMMEDFTWSDFAGSINTYQPGDGSCVSDPCWYNVGLPNLKHTEALIIECHTA
QSCKNFVTDNIQLYPQVLEPASVICMNATAALNPDLGFTCKNGTYSPLSN

Enzyme Prediction     

EC	3.2.1.67:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	65	390	5.5e-38	0.9046153846153846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.14e-21	106	344	47	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	7.96e-17	66	387	105	388	polygalacturonase
178580	PLN03003	2.04e-14	79	338	82	347	Probable polygalacturonase At3g15720
177865	PLN02218	5.50e-14	106	322	149	381	polygalacturonase ADPG
215426	PLN02793	5.55e-13	171	403	211	428	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44512.1|GH28|3.2.1.67	1.43e-313	1	410	1	410
ABD61565.1|GH28|3.2.1.67	3.48e-285	1	410	1	440
ABD14402.1|GH28	7.02e-285	1	410	1	440
BCS06604.1|GH28	6.15e-279	1	409	1	439
BCR93993.1|GH28	6.15e-279	1	409	1	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CZF_A	2.91e-10	61	366	46	356	Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger],1CZF_B Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger]
1K5C_A	1.93e-09	97	294	61	264	Endopolygalacturonase I from Stereum purpureum at 0.96 A resolution [Chondrostereum purpureum],1KCC_A Endopolygalacturonase I from Stereum purpureum complexed with a galacturonate at 1.00 A resolution. [Chondrostereum purpureum],1KCD_A Endopolygalacturonase I from Stereum purpureum complexed with two galacturonate at 1.15 A resolution. [Chondrostereum purpureum]
1HG8_A	6.54e-09	117	333	81	321	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q27UB0|PGXC_ASPNG	6.19e-286	1	410	1	440	Exopolygalacturonase C OS=Aspergillus niger OX=5061 GN=pgxC PE=2 SV=1
sp|A2QEW2|PGXC_ASPNC	6.19e-286	1	410	1	440	Probable exopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgxC PE=3 SV=2
sp|B8MZZ6|PGXC_ASPFN	2.34e-213	1	406	1	435	Probable exopolygalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxC PE=3 SV=1
sp|Q2UQ40|PGXC_ASPOR	2.34e-213	1	406	1	435	Probable exopolygalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxC PE=3 SV=1
sp|A1D7I1|PGXC_NEOFI	1.50e-212	16	407	18	439	Probable exopolygalacturonase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999736	CS pos: 19-20. Pr: 0.9856

TMHMM  Annotations     

There is no transmembrane helices in An02g12450-T-p1.