CAZyme Information: An02g00460-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An02g00460-T-p1
• CAZy Family: AA6
• CAZyme Description: Has domain(s) with predicted UDP-N-acetylmuramate dehydrogenase activity, flavin adenine dinucleotide binding, oxidoreductase activity, oxidoreductase activity, acting on CH-OH group of donors activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
568		61592.32	4.6207

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An02_A_niger_CBS_513_88:103169-104875(-)

Full Sequence      

MTPSPSKTSLALLAVQFFGLGSACGCACTLDSLNTTLQGRVQPLTPFSLPCFSNYNDQSV
TPNDAACANIQDNYTDPYLRTNSPNGYMNNQDEMCSSNPEDQCLLDSSDPTDPLAFVNQT
CRQGNMPSYYIEVKDETDVRHALHFSNCSGTRLSIKNSGHDYLTRSSGKGTLALWTRKLQ
NLSYSPAFVPDGCQAXYNAITAGAGVNFDEAYEFAHQNNVTILGGYSPTVGLSGGWVMNG
GHSVLSPVYGLGVDRVVQYKVVTPDGELRIANECQNQDLFWALRGGGGGTFGVVLESTHR
VESTISFVAAIIKFTSNSTNVLPFMDIVVNNTLKWAKEGWGGHVTGDTLVNVSPLLSVAE
ASASMAEVAAYAKAQGGSAVIEAFSSWYDFYQKYVTSSSVSVGVTHFAGSRLVPTDVFET
AEGRSNLMDFFELILANGQTPYIPVVAPILYNYTEGSTSASPAWRKSVWELGSGSSWAWN
STLQTREQKIATLQNMTATLERITPGSGAYSNEANAFTVDWQEAWWGDNYDKLLSIKHKY
DPTGLLSCWKCVGWEDSQANSTCFAAFS

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	127	304	2.3e-39	0.3646288209606987

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.11e-18	127	272	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	9.14e-14	200	546	97	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.14e-07	509	545	1	37	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
223882	MurB	7.48e-06	113	275	8	158	UDP-N-acetylenolpyruvoylglucosamine reductase [Cell wall/membrane/envelope biogenesis].
273751	FAD_lactone_ox	0.001	124	322	12	197	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.78e-35	121	546	592	1043
QKD57322.1|CBM91|GH43_11	1.78e-35	121	546	592	1043
ADI58761.1|AA7|1.1.3.-	6.78e-14	138	542	48	460
AAS79317.1|AA7|1.1.3.-	1.73e-13	138	542	73	485
UQC87672.1|AA7	2.29e-13	107	553	52	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	3.43e-60	33	562	46	568	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	2.45e-39	67	556	78	586	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
3HSU_A	3.44e-15	138	542	54	466	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
1ZR6_A	6.06e-15	138	542	54	466	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6JQH_A	2.59e-14	98	319	30	242	Chain A, MaDA [Morus alba],6JQH_B Chain B, MaDA [Morus alba]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A7L8UYL4|FFSJ_ASPFV	9.23e-166	31	562	27	596	FAD-linked oxidoreductase ffsJ OS=Aspergillus flavipes OX=41900 GN=ffsJ PE=3 SV=1
sp|G4MWA7|OXR2B_MAGO7	2.46e-138	31	567	30	580	FAD-linked oxidoreductase OXR2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=OXR2 PE=2 SV=1
sp|P0CU32|CHEF_CHAGB	8.19e-136	32	567	71	612	FAD-linked oxidoreductase cheF OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=cheF PE=2 SV=1
sp|Q0V6Q5|PHMC_PHANO	1.32e-125	11	452	4	422	FAD-linked oxidoreductase phmC OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) OX=321614 GN=phmC PE=3 SV=2
sp|A0A0E0RTV6|ZEB1_GIBZE	2.84e-61	1	566	1	564	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.102789	0.897194	CS pos: 23-24. Pr: 0.8064

TMHMM  Annotations     

There is no transmembrane helices in An02g00460-T-p1.