CAZyme Information: An01g14650-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An01g14650-T-p1
• CAZy Family: AA3
• CAZyme Description: Putative exo-rhamnogalacturonan hydrolase with a predicted role in pectin degradation

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	An01_A_niger_CBS_513_88|CGC17	47770.04	4.8426

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An01_A_niger_CBS_513_88:3500198-3501652(+)

Full Sequence      

MRMPSAISIGVIAGLSVAASAVPSLQKNGTTCTVIPLGNGQDDVPNILSAVDECGQTSGG
RVVLPAPYTYRINQRMTTHLTDSRLEIGGTLLFSDDIDYWVNNSYRVDFQNQSSAWRITG
HDYVVDGGPRQGGVDGNGQLWYTWAKGGSNVFGRPMPVHVFESTRATLRNLAIRQPQFWA
VLVDSSSHINLDNFYVNATNHDSSVSPEGEWVQNTDGIDTYRSDHITVTNWVYQGGDDAV
AFKGNSTNIHVENVTVYGGPGIAFGSLGQYPDRTDIVENVTVRNVRVQPSFQRAMNSGVY
FKSWIGVNYGVPPNGGGGGHGYVRNVSVENLRLKDVQLPVYIDTCLSYLFSENITQYCDT
STYEFEDLHFRNISGNGLATVTDYPGKNISFAVALLCSEKAPCTDLTFQDISITLPGNYT
GKHVLCENAEAEGLPCNS

Enzyme Prediction     

No EC number prediction in An01g14650-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	51	431	1.5e-74	0.9753846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	3.80e-25	132	429	61	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	3.17e-20	38	434	62	412	Probable polygalacturonase
215120	PLN02188	5.26e-20	38	431	46	392	polygalacturonase/glycoside hydrolase family protein
215540	PLN03010	4.90e-18	183	432	176	392	polygalacturonase
177865	PLN02218	5.34e-18	106	429	140	418	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABD61566.1|GH28	0.0	1	438	1	438
ABD14403.1|GH28	0.0	1	438	1	438
BCR93142.1|GH28	9.08e-313	1	438	1	438
BCS05796.1|GH28	9.08e-313	1	438	1	438
QRD93508.1|GH28	3.18e-260	11	438	10	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	3.58e-22	42	438	30	384	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1RMG_A	1.76e-10	15	433	2	357	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2EQQ2|RGXA_ASPNG	0.0	1	438	1	438	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	0.0	1	438	1	438	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|Q2UP32|RGXA_ASPOR	5.65e-261	11	438	10	437	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|B8NJB0|RGXA_ASPFN	5.65e-261	11	438	10	437	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|A2QG68|RGXB_ASPNC	1.36e-76	4	436	3	415	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999721	CS pos: 21-22. Pr: 0.9564

TMHMM  Annotations     

There is no transmembrane helices in An01g14650-T-p1.