CAZyme Information: An01g12020-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An01g12020-T-p1
• CAZy Family: AA3
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN12445, A. fumigatus Af293 : Afu8g02020, A. niger CBS 513.88 : An04g09400, A. oryzae RIB40 : AO090010000196 and Aspergillus terreus NIH2624 : ATET_08038

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712		79889.96	9.0676

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An01_A_niger_CBS_513_88:2831913-2834170(-)

Full Sequence      

MSRKHARNSMVEDVVIPAHLLAATTQVNGPFTARSDEASESGPGPIHQAIRTEALERQFG
QLRRSASVNSSHPQKPKDTRFRRQSAPLSVAEISTIAEIEPAQLSPNGSSHVQWQHGQDD
FGAHSRQLSESIPATRGDAWPLPPRPHSYRISRIEPTEEPPQRTNRHSIYDVYEKAKERR
IALQRKYWVQVLFEYTVYIFLAAFIYFVLIGMPLWRGAVWWLYYVVRTKFVIPGGWGITI
GIAILYAFTPLLLLFEKNPPPVDSNSKEGDLEGNRNTAKSTALLIPCYKSANIIGPTLDA
ALHIFPPENIFVIANGNSPEPLDNTEEVCRPYGVNHLWCPVGSKIIAQFVGCYAAKEFPH
VLLIDDDCALPPNFPVVSDRLKGRVQCIGYTIKSVGPESSRGTLCQQAQDLEYKISGLQR
AFAGLLGSATFPHGAISLWKTDFLKQTFHDHPGFSVSEDWFFGDSCRRLGGRIKMCSAVF
VETETPSAVFFSSGGSRGGFGEMTIFKQRFMRWNFFFVNGMWYNMKYILCSWNLGFWELG
AKLFVFQEVYETLLYLLAPFVLPISLVVQPAFCGIMLGVTNGLYFLNVVIFNLVHLRLKK
EAVSWKCLLLYYMPYKIVLFIINVVSCYWSLFKYARYFATRHPKVIEDDKAVEVVLRLED
TTNNDPKPTNKAPGLGRSFSVTKVRARKTSNAGSKPAGPGGVSVAGAEGSWI

Enzyme Prediction     

No EC number prediction in An01g12020-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	281	489	8.4e-27	0.9260869565217391

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404520	Glyco_tranf_2_3	1.46e-32	281	487	4	215	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
404513	Glyco_trans_2_3	6.01e-07	360	585	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
132997	Glyco_tranf_GTA_type	3.20e-05	284	374	2	94	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44102.1|GT2	0.0	1	712	1	712
BCR93365.1|GT2	0.0	1	712	1	714
BCS06011.1|GT2	0.0	1	712	1	714
QKX60961.1|GT2	1.24e-288	1	692	1	691
UPL00273.1|GT2	5.20e-273	5	699	2	692

PDB Hits     

An01g12020-T-p1 has no PDB hit.

Swiss-Prot Hits     

An01g12020-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

Start	End
513	535
545	567
572	594
609	631
191	213
233	255