CAZyme Information: An01g09510-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An01g09510-T-p1
• CAZy Family: PL4
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN5663, A. fumigatus Af293 : Afu4g13710, A. oryzae RIB40 : AO090010000145, AO090009000200, Aspergillus wentii : Aspwe1_0106727 and Aspergillus sydowii : Aspsy1_0057029

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
568		63937.45	6.1053

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An01_A_niger_CBS_513_88:2274988-2276810(+)

Full Sequence      

MAPPLHRRSWRQSRASALIFAAAFFSAGFILFFYSRPSYVAPIPDLETSPSLASPDDTNP
CFVDLDLLRQYSSTATVQYARLEIAVTSTENFTGYTDTLSTRFPKFHTVRLDTEAPREDL
SPEKCTATVTIEGPQPSAPPDASHIIFGLSTSTDRLIDSLDAFAHWAAGTNARILAVVDS
GGRKKEAERRAQALGIRLTILQEDNERLDRYFYLVQYLYKHKDKSTQWVVMMDDDTFFPS
MTRLVDRLATYDASMPQYVGAVTEDLQQMYSSGYMAYGGAGIFLTIPLLEQLQPWFDECY
VFKGGGDHMLSQCIYKHTNTKLSWERDLFQLDLRGDASGFYEAGRAQPLSVHHWKSWFQA
DMVALSKASSICGEECLLHRWLLQDEWYLVNGFSVIKYSTVSDDPLAMEQTWNASQYTGP
NPFTYSLGPLRRKDEKKISFRMRDVVQEKERVRQIYVHEVTPEELEVLEVEEAGKYVKLP
STSSSPRGTRPSHLIAPGQARSVNLPTCLVEVPAFASSRRAVMETNFSLISCIAFLWAAT
PPPASPTMNGSPQLLQVARFAGSNQKPM

Enzyme Prediction     

EC	2.4.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	2.97e-12	227	353	212	341	hypothetical protein; Provisional
398362	DUF604	3.49e-07	267	353	1	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	7.86e-06	228	295	87	162	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44001.1|GT31	0.0	1	568	1	568
BCR96058.1|GT31	0.0	1	470	2	471
BCS08579.1|GT31	0.0	1	470	2	471
QMW36933.1|GT31	3.09e-185	10	470	10	465
UCK57270.1|GT31	4.38e-185	10	470	10	465

PDB Hits     

An01g09510-T-p1 has no PDB hit.

Swiss-Prot Hits     

An01g09510-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000002

TMHMM  Annotations     

Start	End
13	35