CAZyme Information: An01g06500-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An01g06500-T-p1
• CAZy Family: AA2
• CAZyme Description: Predicted mannan endo-1,6-alpha-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456		50761.19	4.3047

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An01_A_niger_CBS_513_88:1536285-1537796(+)

Full Sequence      

MVVPGWIWAVFLTIFVSFQRTVTALQLDINDERRTTAFNMMSYYHGNESGQTPGKLPDTW
WEGGAMFMTLIQYWYWTGDTSYNEVTTQGMLWQKGDNDYFPANDSNYLGNDDQVFWGLAA
MTAAELNYPEQDGQPSWLSLAQGVFNTQVPRWDTTSCQGGLRWQIWPYQAGYTTKNAISN
GGLFQLAARLGRYTNNDTYTDWAEKIWDWSATTPLLQTEDWYIADTTTTEANCKDHGDIQ
WTYNYGTYLSGAAYMYNLTNGADKWKKGLDGLLASTFSRFFPKEYGSNIMSEISCEPNMM
CDRNQDCFKGFLSSWLTFTTTIAPYTADQILPKIQQSALAAAKQCSGGDSGTQCGRRWYQ
AQWDGETSLESDMSALSVFSSNMITHRQSQGGQSQGPLTSDTGGTSQSNPNAGTGPKDAP
NKLPDITTGDRAGASILTVLFVGSWAGAITWLVYGG

Enzyme Prediction     

No EC number prediction in An01g06500-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	24	389	1.2e-102	0.9497206703910615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	29	376	2	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	0.009	167	266	137	232	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43770.1|GH76	0.0	1	456	1	456
BCR95806.1|GH76	0.0	1	456	1	462
BCS08339.1|GH76	0.0	1	456	1	462
QMW25974.1|GH76	8.15e-268	4	456	3	457
QRD87981.1|GH76	8.15e-268	4	456	3	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	5.50e-99	28	431	35	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P6I3|YHG7_SCHPO	7.74e-104	29	441	30	429	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	1.18e-102	12	453	9	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|P36091|DCW1_YEAST	2.15e-102	20	454	17	449	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	1.56e-101	21	454	15	446	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	2.74e-98	12	422	3	418	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.073293	0.926673	CS pos: 24-25. Pr: 0.8731

TMHMM  Annotations     

Start	End
432	454