CAZyme Information: An01g03090-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An01g03090-T-p1
• CAZy Family: AA1
• CAZyme Description: Glucan endo-1,3-beta-D-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
957	An01_A_niger_CBS_513_88|CGC12	102889.26	5.1924

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An01_A_niger_CBS_513_88:734393-737584(+)

Full Sequence      

MERKHRWGSSFLLMWLLAAEGVYSAPRRSSSTASPKTQFPPGAETERILPGTNGLYPTSL
EREGHPVLPTPTSTGNTKDPWGLDGLLESLGDTADLPNELLSEFLPGWGKNYPVTVPVSA
YKPASAETTSSATEPQTQPETSDTSTPQAPSQNVPEATTDSSQVSSQASSTTSLTQPSST
TSTTQLSSTTSPTQPTSSASSAQPSSSASLTTTASQTTQADNSITSSVVQASVTPMSGQD
VFVPLATTPFPQTITARNDHPVPKKGIENVTTPIETNKFYAGLFLGSQSNTTFTHPYGLS
WAKGSGNAKSYGMAISHNEVNVVANGPTNANIPGNPISYYINPIGIQHMILSATELNTST
VLTAENLLPFSADAVLSPTPGSSQRITIPLVQGMGFVTGMYNNLQPLIQSGVFFSKVVTA
SSPRIGIYKYKVSLADGTEWLVYAIPQDGKDPDFRLESNTDFRGPSGWSGTVQITKNPAG
DSGEKLLDGSSGVFALEAAVSGSVQDNSGTYNLAFAKSGKQLQQTPLLMYALPHHVESFD
NTTKGRMTSITLRTTTKGNATAVVGETWTMLEPNLPTQMGFDPWSVSAGNVNNLSAAAKQ
VILSVAPTELNQSIDQQSDLNSMYYSGKALSKFATLVYTVNKLGGNPDLAASALQNLKTA
FSRFVDNKQQFPLVYDSVWKGVVSSASYGGDSGADFGNTYYNDHHFHYGYFIHAAAIIGS
LDSTWLTDSNKAWVNMLVRDAGNSAANDPYFPFSRSFDWYHGHSWAKGLFESFDGKDEES
TSEDTMFAYALKMWGKTIGDASMEARGNLMLGILRRSLHNYFLMESDNKNQPANFIANKV
TGILFENKVDHTTYFGNNLEYIQGIHMLPLLPSSPYVRSQNFVREEWNALFSANATDPAL
NVTGGWKGVLYANLALIDPASSWNFFAQSNFDYSWIDGGASRTWYLAFAAGLGGGPA

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	258	948	2e-232	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	260	957	75	760	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	593	946	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	2.83e-149	260	585	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43675.1|GH81	0.0	1	951	1	951
BCR95538.1|GH81	0.0	1	957	1	941
BCS08078.1|GH81	0.0	55	957	10	896
QMW40391.1|GH81	0.0	1	954	1	909
QRD82801.1|GH81	0.0	1	954	1	909

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBZ_A	2.57e-108	231	950	23	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K3A_A	2.74e-108	238	950	5	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K35_A	2.89e-105	238	923	5	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.09e-28	624	929	340	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	8.25e-18	624	942	361	674	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	236	951	188	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	9.95e-181	240	956	2	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.94e-167	240	952	46	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	2.91e-164	247	952	407	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	5.75e-164	240	951	427	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000291	0.999683	CS pos: 24-25. Pr: 0.9776

TMHMM  Annotations     

There is no transmembrane helices in An01g03090-T-p1.