CAZyme Information: Afu8g06890-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu8g06890-T-p1
• CAZy Family: GT76
• CAZyme Description: Putative xylogalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		42663.79	7.2108

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr8_A_fumigatus_Af293:1690962-1692240(+)

Full Sequence      

MHKMLYPRNLALFSLLSLSSAAPSQVERSPDAVLKPRAVCTPTAGGSPSIDDVPAIRKAI
ASCGNGGTIVFPAGSTYYLNSVLDLAGCSNCDIQVEGVLKFSGSTEYWGGKTAMLNIDMI
NGLRLRSLTGSGVIDGNGQNAYDRFASDKNYKRPTLLYITGGSNIEVSGLRQKNPPNVFN
SVKGDTQHVTFKNLRMDATSNSQNPPKNTDGFDIGASTHVTISSVSVTNDDDCVAFKPGS
NYVTVEDVTCTGSHGISVGSLGKSGPDVVQNILAHRITMIESTKAAGIKTYPSGNGHGLS
TVKNVTFSDFNVRGCDYAFQIESCYGESESYCESNPGNAILQGIVVKGFSGTTSGKYDPV
VANLNCGARGTCDVSMSAFSVKAPSGKATVLCDNTPSSLGVSCTSGASG

Enzyme Prediction     

EC	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	58	396	1.6e-66	0.9723076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.38e-40	63	403	1	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	2.42e-28	44	394	54	388	polygalacturonase
177865	PLN02218	1.37e-26	44	394	75	417	polygalacturonase ADPG
178580	PLN03003	3.05e-25	44	372	31	347	Probable polygalacturonase At3g15720
215120	PLN02188	1.90e-21	44	371	44	362	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAL85450.1|GH28|3.2.1.-	3.44e-300	1	409	1	409
ASO96840.1|GH28	3.39e-272	4	409	1	406
QMW43960.1|GH28	2.04e-220	9	409	6	406
QRD90994.1|GH28	2.04e-220	9	409	6	406
QMW31926.1|GH28	2.04e-220	9	409	6	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	1.10e-209	22	409	1	388	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
6KVH_A	3.91e-29	30	403	2	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
6KVE_A	5.39e-29	30	403	2	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1NHC_A	1.23e-28	58	403	13	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
7E56_A	1.69e-28	69	403	26	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WBT4|XGHA_ASPFU	2.13e-298	4	409	1	406	Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xghA PE=3 SV=2
sp|B0Y9F8|XGHA_ASPFC	2.04e-296	4	409	1	406	Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xghA PE=3 SV=2
sp|A1DBT5|XGHA_NEOFI	9.30e-261	4	409	1	406	Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xghA PE=3 SV=1
sp|B8NPS8|XGHA_ASPFN	3.62e-221	9	409	6	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xghA PE=3 SV=1
sp|Q2UBD8|XGHA_ASPOR	5.98e-220	9	409	6	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xghA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000650	0.999331	CS pos: 28-29. Pr: 0.4281

TMHMM  Annotations     

There is no transmembrane helices in Afu8g06890-T-p1.