CAZyme Information: Afu8g05910-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu8g05910-T-p1
• CAZy Family: GT62
• CAZyme Description: Pectate lyase E, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254		26828.33	8.4725

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr8_A_fumigatus_Af293:1399687-1400517(-)

Full Sequence      

MYQPLLLLPLLLTSAFATPHDPTTHQALEKRASFPIPSSKGSVTYSSPKTISGTFDGGLK
TYGRGVKCTGQKEGGEKDAVFVLEDGATLKNAIIGADQIEGVYCKGSCTIQNVWWTDVCE
DALSLKGTGSGTHRIIGGGARNADDKVIQHNSGGKVIIQDFTVQNFGKLYRACGNCSKQF
KRTVEISGVKASSGKALVGINSNYGDTATISGCASSVKEICVEYEGTDNNKKEPAKKSSG
PSNACKYKEPLASC

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	40	226	6.1e-77	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	3.42e-114	33	231	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50862.1|PL3_2|4.2.2.2	2.98e-166	1	254	1	254
EAA63305.1|PL3_2|4.2.2.2	2.98e-166	1	254	1	254
QRD92807.1|PL3_2	5.83e-144	1	254	1	257
QMW36211.1|PL3_2	5.83e-144	1	254	1	257
BAE66524.1|PL3_2	5.83e-144	1	254	1	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	1.27e-25	54	190	16	154	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	1.89e-23	54	198	21	160	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.94e-23	54	198	22	161	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
3B90_A	1.43e-22	76	226	30	196	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4Z05_A	1.74e-22	54	198	30	169	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WC29|PLYE_ASPFU	3.28e-186	1	254	1	254	Probable pectate lyase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyE PE=3 SV=1
sp|B0Y9M8|PLYE_ASPFC	3.28e-186	1	254	1	254	Probable pectate lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyE PE=3 SV=1
sp|A1DBJ7|PLYE_NEOFI	7.96e-178	1	254	1	254	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|Q5B7Z3|PLYE_EMENI	5.29e-167	1	254	1	254	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1
sp|A1C4B8|PLYE_ASPCL	1.30e-151	1	254	1	254	Probable pectate lyase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=plyE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999702	CS pos: 17-18. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in Afu8g05910-T-p1.