CAZyme Information: Afu8g04500-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu8g04500-T-p1
• CAZy Family: GT57
• CAZyme Description: Putative protein O-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780	Chr8_A_fumigatus_Af293|CGC8	88808.93	8.7176

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr8_A_fumigatus_Af293:1019076-1021542(+)

Full Sequence      

MSSSPSSSLRKRGGRKEAYSPLPSDDASSPLSSSKPSVASTNQSGWDYRLALVVLTILAF
ITRFYKISYPNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFMGWLIGYDGHFLF
DNIGDSYIDNKVPYVALRAMPATLGALTIPVVFLIMWESGYSLPACVLAAGLVLFDNAHV
GEDRLILLDASLVLSMALSILCYVRFYKLRHEPFGRKWWKWLLLTGVSLSCVISTKYVGV
FTFVTIGAAVLVDLWNLLDINRPSGALSMAHWTKHFAARAFALIIVPFFFYLFWFQVHFA
ILTRSGPGDDFMTPEFQETLSDNLMSAQSIGIQYYDTITIRHKDTKVFLHSHWEKYPLRY
DDGRISSQGQQVTGYPFNDTNNHWQILPSVPYPETDRQGHSVKNGDIVQLRHVGTDTILL
THDVASPYYPTNQEFTTVSHELANGERHNDTLFEIKIENGKPQQEFRSLSSHFKLIHVPT
RVAMWTHTTPLPEWAFKQAEINGNKNILQTSNLWFVDTIESLEENSPRAIKKERQVKHLP
FWRKYLELQRAMFFHNNALTSSHPYASEPFQWPFLLRGVSFWTKNDTREQIYFLGNPIGW
WIASSLLAVFVGVIGADQLSLRRGVDALEEIWGRGARSRLYNSTAFLFLCWAAHYFPFWL
MGRQRFLHHYLPAHVASCMVAGALIEFIFNLQPISVARAVKEDDPTGKSKAHGSAGHFVT
AKERMGRQSLIAGWVATLVILSLTIWGFCFFAPLTYGTPGLDVAGVNARKWLGYDLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	55	299	1.1e-73	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	47	780	22	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	2.06e-83	53	303	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	2.07e-76	543	772	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	3.21e-17	344	497	7	164	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	2.66e-07	332	389	4	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS03793.1|GT39	0.0	1	780	1	775
BCS15407.1|GT39	0.0	1	780	1	775
CAK42948.1|GT39	0.0	1	780	1	771
QMW29154.1|GT39	0.0	1	780	1	775
QMW41228.1|GT39	0.0	1	780	1	775

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	4.94e-101	49	775	50	728	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	5.77e-97	53	760	69	737	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
1T9F_A	4.60e-06	349	480	24	139	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42933|PMT4_SCHPO	1.11e-259	48	772	58	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q59X23|PMT4_CANAL	4.68e-258	6	780	2	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	1.83e-246	48	780	52	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q8R2R1|POMT1_MOUSE	5.61e-118	47	771	36	736	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	8.08e-118	47	771	36	736	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999937	0.000037

TMHMM  Annotations     

Start	End
48	65
92	114
135	157
185	207
227	249
276	295
592	614
640	662
730	752