CAZyme Information: Afu8g02070-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu8g02070-T-p1
• CAZy Family: GT4
• CAZyme Description: Ortholog of A. niger CBS 513.88 : An05g02310, A. oryzae RIB40 : AO090010000612, Neosartorya fischeri NRRL 181 : NFIA_095740 and Aspergillus clavatus NRRL 1 : ACLA_043710

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	Chr8_A_fumigatus_Af293|CGC8	38814.97	9.5270

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr8_A_fumigatus_Af293:535064-536184(-)

Full Sequence      

MARNRIRLLLILLLALSIGGLFSSSLRQLYYLLRLPFVWKASSAASIISQEHDQFDVTFA
AFEANYSTAELGRPALIPPILHHIHLGSRPPREEWLEARELCLKHHASWSTFVWNEESAE
KLVREDFPHLYEMWKGYPYMIQRVDALRYMILHKHGGVILDYDLACKRSLEPLRQFDFVA
PAAHPAGLSIGMMLASTGNPYVKALVDNLPLYNRRWLYLPYVTVMFSTGCHYASTIYTLQ
SNRSSLRILSGPPDAPRLHKLNGQVNTPLFRHLGSSSWHNRDARLISLFKNLDQRALFAA
LVFGLFALTTMILCCVQRGRGCGRASDEEQSTAVSKSLTKNA

Enzyme Prediction     

No EC number prediction in Afu8g02070-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	94	174	9.1e-17	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.59e-23	63	229	68	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.32e-14	93	173	2	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65563.1|GT32	5.96e-152	4	330	4	329
QRD92706.1|GT32	8.00e-150	4	330	4	329
QMW36301.1|GT32	8.00e-150	4	330	4	329
QMW48357.1|GT32	2.28e-149	4	330	4	329
CAK44892.1|GT32	6.09e-136	1	316	1	316

PDB Hits     

Afu8g02070-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	2.92e-32	74	308	59	289	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	4.48e-32	73	308	51	281	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	5.49e-32	75	313	55	287	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	6.99e-26	58	330	45	313	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	1.32e-23	72	286	78	289	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.923471	0.076545

TMHMM  Annotations     

Start	End
9	31
294	316