CAZyme Information: Afu8g02040-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu8g02040-T-p1
• CAZy Family: PL1
• CAZyme Description: Putative alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	Chr8_A_fumigatus_Af293|CGC3	44554.86	8.9384

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr8_A_fumigatus_Af293:530708-531997(+)

Full Sequence      

MGPQRFKRQFIVAILLAASIIWLMRSFEHEDADVARTMPLLQKYIHPPSGKGGAWYIPPS
WLENATTAPESIVDAAKLASDKAQAPERQITLSSIPMIVHQTWKTTDPQTWPPPIRQSTE
SWLRAVEQDQMAYFLWDDEGINQFIKHFEPGLETQFYALGSNVERTDVFRILVSKWIGGV
YGDMDTEPLRKPKSWINASDTQPWRDPDTGAVYRSTKPVRAIVGLEADCPPGSDLYWRMG
YTHPVQLTQWAFAWAPGHPILQMFLDRFSAAMQERSNQAVDPLVLTGPVAFTEAVQSWLV
ATTGLRWNALTGLHDGGRSKVVEDVLVLPITGFSPGRGRYGNMGSKPVTDPSARLRHRAQ
GSWRKFDLLVEYGKFCRTVFGRCRNWTKVPHTSF

Enzyme Prediction     

No EC number prediction in Afu8g02040-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.90e-17	95	270	82	245	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.93e-08	116	196	5	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48355.1|GT32	5.82e-183	5	391	7	412
UDD65561.1|GT32	9.03e-180	5	391	7	412
QMW36299.1|GT32	1.28e-179	5	391	7	412
QRD92708.1|GT32	1.30e-177	5	391	7	414
BCR93027.1|GT32	1.85e-176	1	390	1	408

PDB Hits     

Afu8g02040-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.47e-24	93	364	140	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	5.01e-19	96	364	100	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	3.50e-13	95	365	96	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	6.57e-11	96	334	131	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	3.19e-09	93	196	55	159	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999991	0.000035

TMHMM  Annotations     

There is no transmembrane helices in Afu8g02040-T-p1.