CAZyme Information: Afu7g06740-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu7g06740-T-p1
• CAZy Family: GT2|GT2
• CAZyme Description: Has domain(s) with predicted cellulase activity, cellulose binding, hydrolase activity, hydrolyzing O-glycosyl compounds activity, role in carbohydrate metabolic process and extracellular region localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	Chr7_A_fumigatus_Af293|CGC16	24645.26	4.1833

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr7_A_fumigatus_Af293:1639491-1640272(+)

Full Sequence      

MLYFTLLHSMTDQRGSDTMTDRKELVAVEHRLLGISNGVYTAAGSQALFDTAGASWCGAG
CGKCYNLTSTGSAPCTGCGTGGAAGESIIVMVTNLCPYNGNQQWCPQVGATNNYGYSYHF
DIMAQSEVFGDNVVVNFEPVACPGQATSDWETCVCYGQTETDETPVGMTPGGSNPSPLTS
TTTTKTTTTETTITTTTSGATQTLYGQCGGSGWTGPTACASGATCKVLNPYYSQCLS

Enzyme Prediction     

EC	3.2.1.4:3	3.2.1.4:3	1.14.99.54:4	1.14.99.56:4	3.2.1.55:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM1	205	232	1.1e-16	0.9310344827586207

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409015	DPBB_GH45_endoglucanase	3.07e-22	40	142	38	149	double-psi beta-barrel fold of glycoside hydrolase family 45 endoglucanase EG27II and similar proteins. This group is made up of endoglucanases from mollusks similar to Ampullaria crossean endoglucanase EG27II, a glycoside hydrolase family 45 (GH45) subfamily B protein. Endoglucanases (EC 3.2.1.4) catalyze the endohydrolysis of (1-4)-beta-D-glucosidic linkages in cellulose, lichenin, and cereal beta-D-glucans. Animal cellulases, such as endoglucanase EG27II, have great potential for industrial applications such as bioethanol production. GH45 endoglucanases from mollusks adopt a double-psi beta-barrel (DPBB) fold.
395595	CBM_1	1.57e-12	204	232	1	29	Fungal cellulose binding domain.
197593	fCBD	3.81e-11	204	236	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
409011	DPBB_EXPA_N	2.09e-06	38	142	34	129	N-terminal double-psi beta-barrel fold domain of the alpha-expansin subfamily. Alpha-expansins (EXPA, expansin-A) have cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. They also affect environmental stress responses. Arabidopsis thaliana EXPA1 is a cell wall modifying enzyme that controls the divisions marking lateral root initiation. Nicotiana tabacum EXPA4 positively regulates abiotic stress tolerance, and negatively regulates pathogen resistance. Wheat TaEXPA2 is involved in conferring cadmium tolerance. Alpha-expansins belong to the expansin family of proteins that contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This model represents the N-terminal domain of alpha-expansins, which adopts a double-psi beta-barrel (DPBB) fold.
409008	DPBB_EXP_N-like	2.07e-05	40	142	33	117	N-terminal double-psi beta-barrel fold domain of the expansin family and similar domains. The plant expansin family consists of four subfamilies, alpha-expansin (EXPA), beta-expansin (EXPB), expansin-like A (EXLA), and expansin-like B (EXLB). EXPA and EXPB display cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. EXPA proteins function more efficiently on dicotyledonous cell walls, whereas EXPB proteins exhibit specificity for the cell walls of monocotyledons. Expansins also affect environmental stress responses. Expansin family proteins contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This family also includes GH45 endoglucanases from mollusks. This model represents the N-terminal domain of expansins and similar proteins, which adopts a double-psi beta-barrel (DPBB) fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA20713.1|CBM1|GH45	3.98e-106	33	236	47	251
UKZ88838.1|CBM1|GH45	8.90e-102	33	237	47	248
UKZ63968.1|CBM1|GH45	2.01e-100	33	236	48	246
AGW24295.1|CBM1|GH45	2.54e-98	33	236	47	265
ACF33814.1|CBM1|GH45|3.2.1.4	2.54e-98	33	236	47	265

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBU_A	6.75e-21	40	156	56	181	Crystal structure of GH45 endoglucanase EG27II in apo-form [Ampullaria crossean],5XBX_A Crystal structure of GH45 endoglucanase EG27II in complex with cellobiose [Ampullaria crossean],5XC4_A Crystal structure of GH45 endoglucanase EG27II at pH4.0, in complex with cellobiose [Ampullaria crossean],5XC8_A Crystal structure of GH45 endoglucanase EG27II at pH5.5, in complex with cellobiose [Ampullaria crossean],5XC9_A Crystal structure of GH45 endoglucanase EG27II at pH8.0, in complex with cellobiose [Ampullaria crossean]
5XCA_A	9.84e-20	40	156	56	181	Crystal structure of GH45 endoglucanase EG27II D137A mutant in complex with cellobiose [Ampullaria crossean]
1WC2_A	4.63e-15	34	152	42	167	Chain A, ENDOGLUCANASE [Mytilus edulis]
1CBH_A	6.01e-15	201	236	1	36	Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2CBH_A Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2MWJ_A Chain A, Exoglucanase 1 [Trichoderma reesei],2MWK_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X34_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X35_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X36_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X37_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X38_A Chain A, Exoglucanase 1 [Trichoderma reesei]
5X39_A	4.46e-14	201	236	1	36	Chain A, Exoglucanase 1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43317|GUN5_HYPJE	2.32e-98	33	236	46	241	Endoglucanase-5 OS=Hypocrea jecorina OX=51453 GN=egl5 PE=3 SV=1
sp|P82186|GUN_MYTED	2.38e-14	34	152	42	167	Endoglucanase OS=Mytilus edulis OX=6550 PE=1 SV=1
sp|Q9P8P3|GUX1_TRIHA	4.28e-14	200	236	469	505	Exoglucanase 1 OS=Trichoderma harzianum OX=5544 GN=cbh1 PE=1 SV=1
sp|P19355|GUX1_HYPRU	4.84e-13	199	236	477	514	Exoglucanase 1 OS=Hypocrea rufa OX=5547 GN=cbh1 PE=3 SV=2
sp|O14405|GUN4_HYPJE	1.51e-12	199	237	306	344	Endoglucanase-4 OS=Hypocrea jecorina OX=51453 GN=cel61a PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.923342	0.076682

TMHMM  Annotations     

There is no transmembrane helices in Afu7g06740-T-p1.