CAZyme Information: Afu7g06430-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu7g06430-T-p1
• CAZy Family: GT25
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN5231, A. oryzae RIB40 : AO090012000101, Aspergillus wentii : Aspwe1_0167924, Aspergillus sydowii : Aspsy1_0091759 and Aspergillus terreus NIH2624 : ATET_07909

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	Chr7_A_fumigatus_Af293|CGC6	40469.37	6.4342

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr7_A_fumigatus_Af293:1576149-1577243(-)

Full Sequence      

MPGHFGQKILKTLGLDEQRSPQLFHPQNDARLPGNRLINNDERLLSSDPSGTYPRLAKLS
DGSILSAFTRFAGQTRILTVAKSTDGGRTFHDFGEVTRSQGDCDNLFLLEVAPSIVLGAF
RNHDLGPNGPTHFRITVCRSTDGGRSWQYASQAVEKSPPNGIWEPFMRLGRQGEVQLFYS
QEYAHDNQCTMLVRSFDQGSSWSPPECLEGINDRIRDGMTGITSTVDHGREALVMVFETT
RYGTFNLEALLSYDDGRTWGWRHEVYVPPRAHNAGAPQIASFADGSLAVIFMTDEDERDV
QWPNNACIKMVFAGPPQDGRISWTQPTVICPHRSHWPGVLALDHHTLLAVYECGGPKGKT
VTLQ

Enzyme Prediction     

No EC number prediction in Afu7g06430-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	50	306	2.6e-69	0.8957654723127035

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	5.59e-11	114	358	26	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	4.11e-09	68	296	103	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	8.53e-05	59	209	153	300	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	0.002	46	150	194	296	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA62412.1|GH93	1.21e-193	1	364	1	367
QMW42642.1|GH93	8.39e-190	1	363	1	378
QMW30589.1|GH93	8.39e-190	1	363	1	378
QRD89469.1|GH93	8.39e-190	1	363	1	378
BAE60328.1|GH93	8.39e-190	1	363	1	378

PDB Hits     

Afu7g06430-T-p1 has no PDB hit.

Swiss-Prot Hits     

Afu7g06430-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000020

TMHMM  Annotations     

There is no transmembrane helices in Afu7g06430-T-p1.