CAZyme Information: Afu7g05200-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu7g05200-T-p1
• CAZy Family: GT20
• CAZyme Description: Ortholog(s) have extracellular region localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
868	Chr7_A_fumigatus_Af293|CGC18	97324.53	5.9060

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr7_A_fumigatus_Af293:1225797-1228403(+)

Full Sequence      

MTGNLQWLTNYGHDSLAAGVSFGMPWPKGLYQPGQSFVIEENGREYAIDSREIAYWADGS
LKWTAHSVSGHVGYSEGYTVKGTSESKDTDAGVFIEEGDSLTVTTRRGLQVTFAREGTSS
LFGSLSLRGHALCSGATLVASINDTEYSAIVKKVEVENATNSRAVIKISGTMAASDSEHL
PFDVRVCIYSDAIPIKILHSFVHDLDADEPLASLGIRFSVPLENTELYNRHIQFAGSNGG
ILKEEVQGLSGLRHGPTVKNRIDQSAGRAVTLKQEEWSRTDLRQGLSYIPSFDSYTLSQL
SSDGFTIKKRTKQGCSWVKVTGGGRADGTVYLGSARHGGIAVGMSDFWERYPTQLDLTGL
TQREGAITVWLYSPLAEPLDTAPYHDGLGLDSYEKQLHALDVTYEDYEPGFATANGIGRT
NQFFLKPYTSTPSNQELSSFSALVRNPPRLIPAAEYMYSTGVFHGCWSPAHQQPASQEAT
IEHNLDLLFSHYQKQIEQHRWYGFWDHGDVQHTYDPYRHAWRYDVGGFAWDNSELSTDLW
LWLYFLHTRRADVFKMAEAITRHTSEVDTYHTGRFKGFGTRHGVQHFSDSSKQLRISNVL
YKRIYYYLTGDERIGDLISEQQDCQFALLTLDSHRKVQAHADIPDGFAMTNIGLDCGALA
AAWLTAWERRTEGWEHCRDHLIKLLDGIARLKHGIGNNAILLNPTTGEIRECPPPTPEYA
ISHLSMLFGFPEIFAELLDYARDVDPATVDRFMAVWLSYCKAYNGGAEVQRREFGFAFPD
HATWRQSHSTLTAFAAVQLKSAELARAAWDQFLHTDGYTEEHDWRVVETAPPEYFTHGEE
AAWITTNEAARYGVSAMFNLANIREYLR

Enzyme Prediction     

EC	4.2.2.24:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL26	4	866	5.1e-282	0.9965197215777262

CDD Domains     

Afu7g05200-T-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92176.1|PL26	0.0	2	867	3	872
QKX63791.1|PL26	2.15e-228	5	867	4	913
QGI88329.1|PL26	3.35e-224	5	867	31	916
QGJ01886.1|PL26	3.35e-224	5	867	31	916
QGI70996.1|PL26	3.35e-224	5	867	31	916

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XQG_A	6.08e-224	18	867	21	901	Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQJ_A Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum]
5XQ3_B	4.84e-223	18	867	21	901	Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQ3_A	5.15e-223	18	867	21	901	Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQO_A	1.93e-222	18	867	21	901	Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum],5XQO_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31530|YETA_BACSU	2.07e-124	5	867	4	846	Uncharacterized protein YetA OS=Bacillus subtilis (strain 168) OX=224308 GN=yetA PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Afu7g05200-T-p1.