CAZyme Information: Afu7g01300-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu7g01300-T-p1
• CAZy Family: GT2
• CAZyme Description: Ortholog(s) have mannosyltransferase activity, role in GPI anchor biosynthetic process, fungal-type cell wall organization and glycosylphosphatidylinositol-mannosyltransferase I complex localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	Chr7_A_fumigatus_Af293|CGC10	42670.97	9.9169

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr7_A_fumigatus_Af293:339489-340709(-)

Full Sequence      

MTSFFDSPSKVIGASIALRAVLLVYGAWQDAHSPIKYTDIDYFVFTDAARYVSRGASPYA
RDTYRYTPLLAWLLLPTTWDSIPGFFAFGKALFALADVVAGWLIAKVLVSAYGMSPSRAL
KYASVWLLNPMVANISTRGSSEGLLGVLVVGLLWAVLSRRVSLAGVILGLGVHFKIYPFI
YGPAVVWWFDAERDGSGSPRGTATARAAREKDDGQDGQGILSKAVDFLTPARIHLTLVAL
ATFSALNVSMYILYDLPFAQNTYLHHLTRIDHRHNFSPYSTLLYLSAAGGARTAFESLAF
IPQLLLSVVVIPLVLGKKSLAGTMLAQTFAFVTFNKVCTSQYFLWYLIFLPFYLPSSSLM
KNPRKGILVGLLWVIAQVCPSLFIPLPR

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	135	378	1.5e-78	0.8473282442748091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.03e-72	10	378	10	376	GPI mannosyltransferase
252941	Mannosyl_trans	1.65e-53	135	377	1	219	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	2.46e-05	47	376	39	345	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65877.1|GT50	1.51e-200	1	377	1	366
BAE66105.1|GT50	3.71e-200	1	377	26	391
QRD92382.1|GT50	2.49e-199	1	377	1	366
QMW36573.1|GT50	3.20e-199	1	377	8	373
QMW48628.1|GT50	3.20e-199	1	377	8	373

PDB Hits     

Afu7g01300-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WAH2|GPI14_ASPFU	2.93e-270	1	377	1	377	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	2.69e-201	1	377	1	366	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	4.44e-183	1	377	1	384	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	7.52e-143	1	377	19	441	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	8.68e-139	5	377	7	364	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000012

TMHMM  Annotations     

Start	End
66	88
93	115
135	157
164	186
231	253
294	316
331	353
366	385