CAZyme Information: Afu7g00240-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu7g00240-T-p1
• CAZy Family: GT15
• CAZyme Description: beta-glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767	Chr7_A_fumigatus_Af293|CGC13	83358.05	8.3841

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr7_A_fumigatus_Af293:66279-68814(+)

Full Sequence      

MGEICPRREDFDIDYILKNASLLEKVSLLAGYDFWHTAPLPRFNVPSVRVSDGPNGVRGT
KFFDGVRAACLPCGTGLAATWDQSLLYDAGVLIGQECLAKGAHCWLVPTVCIQRSPLGGR
GFESFAEDPYATGKLAAAYIRGAQSTGVISTIKHFAANDQEHERISVNAVMSERALREVH
LLPFQIAIADSAPGAVMTCYNKVNGQHLSESKEMLDGLLRREWGWKGLIMSDWFGTYSTA
EALNAGLGLEMPGTTRLRGPLLELAISSRKVSRATLDERARTVLEFVQRARKAEVSAVES
TRDFPEDRRLNRKLAADSIVLLKNESGLLPLNPQTLTSVALIGPNMKTAAFCGGGSASLQ
PYYSTSPYQGITSQLPPGVEVLYETGATSYAFIPELEASEVRTPEGQPGLRMRFYRDPPS
VQERRVLMGFSNPELDRLFYADIEAELIAPATGPFQFGLAVYGSASLFLNDQLIIDNTTV
QRGGTFFFGKGTLEETATVDLVQGQSYQIKVQFASGPSSKLVKPGVVNFGGGAGRLGMVQ
VVDPERAIARAVEAAKRADITILGVGLTRDHESEGFDRSHMDLPPAVASLVTAVLDVAPD
AILLTQSGTPFSMLPWADLVKTHLHAWFGGNELGNGIADVLFGVVNPSGKLPLSFPRRIE
DTPTYLNFGSERGQVTYGEGIYVGYKLLRKSPTSCALSIRARFVVHLLCVLRFDGRHRVR
YTECSKLGRRGRSGSSPAVYRGRSNNVVNRTSHQGAQRISKGGFAAR

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	41	252	3.6e-63	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.91e-64	41	374	56	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.01e-48	319	685	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	1.71e-45	72	667	121	611	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.73e-42	58	285	78	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.23e-24	21	376	61	459	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50857.1|GH3	0.0	1	690	1	702
EAA64717.1|GH3	0.0	1	690	1	702
UPK90003.1|GH3	0.0	10	690	14	705
CCT75247.1|GH3	0.0	9	690	13	704
CEI61991.1|GH3	0.0	10	690	14	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.20e-190	11	696	4	711	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.66e-186	11	696	4	711	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	9.58e-100	12	686	4	531	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.59e-81	17	686	9	529	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.62e-71	12	690	47	697	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0YBJ3|BGLK_ASPFC	0.0	1	767	1	766	Probable beta-glucosidase K OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglK PE=3 SV=1
sp|Q4WA69|BGLK_ASPFU	0.0	1	767	1	767	Probable beta-glucosidase K OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglK PE=3 SV=1
sp|Q5BA18|BGLK_EMENI	0.0	1	690	1	702	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|Q2U9M7|BGLH_ASPOR	2.61e-259	12	690	4	684	Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglH PE=3 SV=2
sp|B8NPL7|BGLH_ASPFN	2.11e-258	12	690	4	684	Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999964	0.000056

TMHMM  Annotations     

There is no transmembrane helices in Afu7g00240-T-p1.