CAZyme Information: Afu6g14400-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu6g14400-T-p1
• CAZy Family: GH95
• CAZyme Description: Pectate lyase C, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		44140.83	4.7242

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr6_A_fumigatus_Af293:3660020-3661430(-)

Full Sequence      

MKLSEPLLVSLAAFSQAVTALVAFPGAEGFGANAIGGRNGQVYVVTNLNDSGTGSLRDAV
SATDRIVVFAVGGVIKISDRIVVSKRVTILGQTAPGDGITVYGNGWSFSNADDAIVRYIR
IRMGKGGSSGKDALGIAEGNRMIFDHVSVSWGRDETFSINGDASNITVQNSIIAQGLETH
SCGGLMQTDGGVSLFRNLYIDNKTRNPKVKGVNEFTNNVVYNWGGGGGYIAGDSAGQSYA
NIIGNYFISGPSTSVTAFTRGNANFHGYVQNNYYDPDKDGQLDGFELGVSSSNYGGMAIM
SSKYNYPAVAYTMSPAEAVTYVTKYAGASKVRDSVDTQLIAQVQSWGTEGGLISDEATMG
GPGTLNGGTPAKDTDGDGIPDEAEKQLGTDPNTNDSMKLHSSGYTYLEVWANSLVPSTYH

Enzyme Prediction     

No EC number prediction in Afu6g14400-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	72	247	1.2e-54	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226384	PelB	6.10e-08	7	331	14	344	Pectate lyase [Carbohydrate transport and metabolism].
408654	TSP3_bac	3.52e-06	373	392	1	20	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
214765	Amb_all	0.005	74	251	5	190	Amb_all domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP91803.1|PL1_2	1.04e-286	1	420	1	420
QRD90936.1|PL1_2	3.35e-239	6	419	5	418
QMW31873.1|PL1_2	3.35e-239	6	419	5	418
QMW43898.1|PL1_2	1.36e-238	6	419	5	418
UDD60834.1|PL1_2	1.58e-237	6	419	5	418

PDB Hits     

Afu6g14400-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WL88|PLYC_ASPFU	3.18e-304	1	420	1	420	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
sp|B0XMA2|PLYC_ASPFC	1.06e-302	1	420	1	420	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
sp|A1DPF0|PLYC_NEOFI	4.44e-295	1	420	1	420	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
sp|Q0CLG7|PLYC_ASPTN	1.86e-250	8	420	7	419	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
sp|B8NQQ7|PLYC_ASPFN	5.95e-240	6	419	5	418	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.051119	0.948855	CS pos: 20-21. Pr: 0.8671

TMHMM  Annotations     

There is no transmembrane helices in Afu6g14400-T-p1.