CAZyme Information: Afu6g14040-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu6g14040-T-p1
• CAZy Family: GH92
• CAZyme Description: Putative alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	Chr6_A_fumigatus_Af293|CGC16	45170.48	6.2726

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr6_A_fumigatus_Af293:3580454-3581641(+)

Full Sequence      

MVEKKFVPITLFPKKARRFTHSGLVAFFLFIYFCITKTSHHVGEPGSYSTPVKAKVGETF
PRKIWQIWKVNPLEFDARDIEVARSWTAKNPGYRYEVLTDQNDLEYVEANFGPLGENRPD
IVETYRSLTAPIIKADLLRYLVMYMEGGVYADIDVEALRPVERFVPSTHDERDINMVIGV
EIDEPQFRDHPILGPKSQSFCQWTFMCKPRQPVMMRLVENILHWLNELSIQQGRPISELQ
LDFDDVITGTGPSAFTNAILSEMSRITGKTVTWQTFHDIPESKVVGGFLVLTVEAFAAGQ
GHSDSGTHNSRNALVKHHYHASGWPTRHPRFNHPIFGEVEKCNWNMDCVRKWDEETAAFA
ALPLEEQERQIATYQAIEEALRKMEPPPQPGFGGF

Enzyme Prediction     

No EC number prediction in Afu6g14040-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	83	166	2.3e-20	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.23e-23	44	221	68	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.40e-14	78	160	3	82	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP95522.1|GT32	4.06e-246	1	387	1	385
QMW40889.1|GT32	1.54e-191	13	378	7	369
BAE58544.1|GT32	1.54e-191	13	378	7	369
UDD56882.1|GT32	1.54e-191	13	378	7	369
QMW28814.1|GT32	3.10e-191	13	378	7	369

PDB Hits     

Afu6g14040-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.29e-33	67	324	146	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	3.10e-28	60	322	99	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.19e-26	60	296	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	5.78e-21	40	266	78	359	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.80e-07	48	162	45	150	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000004

TMHMM  Annotations     

Start	End
21	43