CAZyme Information: Afu6g11980-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu6g11980-T-p1
• CAZy Family: GH76
• CAZyme Description: Pectate lyase superfamily protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	Chr6_A_fumigatus_Af293|CGC11	88012.56	4.4841

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr6_A_fumigatus_Af293:2994433-2997349(+)

Full Sequence      

MSSCITTTIIPTEASTSPRLYRVVPRRYHAHPLSLLTIPVLLGPLTHAAAITAGSSSTES
IQSRQAANGPGYWLESISHQGIAPLGPSGYRVFRNVKDFGAKGDGITDDTAAINEAISSG
ERCGQGCFSSTTTPAIVYFPAGTYVISKPIFDYYNTIITGNPNALPVIKACADFDGGYLI
DGDPYFGPELNWPATTVFWRQVRNLVLDTTDVAARKQISGIHWPTAQATSLQNVIFQLSA
DEGTEHQGIFCESGSAGFAGDLVFNGGKIAAALGNQQFTMRNLTFNHAQTAISHFWNWGW
TYQDITINDCEVGIDISTGGSEQQSVGSITVFDSSFANTPVAIKSAQSESSTPRTAGSII
LENVAINNVATVVQGPSGTVLAGTTRSSVIPGWGQGNRYVPDGPTRFAGDITPVSRPAGL
VVGDGKYYQRSKPQYEQLPVSAFSSVRDGGATGDGTTDDTAALQRVIDSAAASDRVVFLD
AGVYKVTSTLRIPAGSRIVGEAFPVILSSGAFFNNQEEPQPVIQVGQAGQQGHVELSDFI
ISTQGPQAGATLIEWNLASPSDPSGMWEVHARVGGFAGSQQTTRECAKTPETVITEADEK
CIVAYMLMHVTPSASNLYLENTWLWVSDHDIDVQTEADGGQITLYSGRGLNIESTEGNIW
LSGTSVEHNVLYEYQFVSTQNVYMGQIQTETAYYQSNPNALIPFTPKAAIHDPDFASSCK
SSSDGNCEVGWGLRVVDSHDLYVYGAGLYSFFNNYDAGCSTYGGEQNCQNSIFSIEGDSA
ITVYNLNTLGTRSMVDRDGQSLASFSDNISVFTNNIVLFRSQ

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	65	819	5.2e-278	0.9878378378378379

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	6.97e-96	93	315	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.06e-11	443	559	1	125	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
163520	RR_plus_rpt_1	1.39e-04	447	500	38	93	twin-arg-translocated uncharacterized repeat protein. Members of this protein family have a Sec-independent twin-arginine tranlocation (TAT) signal sequence, which enables tranfer of proteins folded around prosthetic groups to cross the plasma membrane. These proteins have four copies of a repeat of about 23 amino acids that resembles the beta-helix repeat. Beta-helix refers to a structural motif in which successive beta strands wind around to stack parallel in a right-handed helix, as in AlgG and related enzymes of carbohydrate metabolism. The twin-arginine motif suggests that members of this protein family bind some unknown cofactor.
227721	Pgu1	1.78e-04	95	151	84	130	Polygalacturonase [Carbohydrate transport and metabolism].
215426	PLN02793	0.006	87	150	47	101	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD47609.2|GH55	0.0	40	821	9	786
ATZ54804.1|GH55	0.0	72	821	70	815
APA06271.1|GH55	1.40e-317	72	821	71	816
AEO64347.1|GH55	2.82e-315	80	821	27	763
AEO59077.1|GH55	9.04e-304	71	822	20	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	1.45e-229	71	821	5	755	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	5.87e-204	54	816	8	752	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	1.23e-07	95	186	76	158	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49426|EXG1_COCCA	7.82e-223	52	816	29	781	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	1.80e-219	40	819	17	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	2.97e-54	35	815	1	744	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.713201	0.286804

TMHMM  Annotations     

There is no transmembrane helices in Afu6g11980-T-p1.