CAZyme Information: Afu6g11910-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu6g11910-T-p1
• CAZy Family: GH76
• CAZyme Description: beta-glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856		91971.04	5.9553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr6_A_fumigatus_Af293:2979806-2982639(-)

Full Sequence      

MGSIDTVGMGQRAIDQIISELSLNEKVALLSGVDAWHTFAIPRLGIPSIRTTDGPNGARG
TRYFNGVPSACLPCGTALGATFDRDLIFSLGQLLAAECRAKGAHVLLGPTINIQRGPLGG
RGFESFSEDPVLSGLAAASYCSGVQDGGVVPTLKHLVCNDQEHERVAVSALVTPRALREI
YLLPFQLAIQGARPGAVMTSYNKVNGLHASENPGLIRDILRGEWGFGTYSVADAVNAGLD
LEMPGPTRFRGPALMHALTSNKVSEKTLNERVRKVLELVQLASRAGVPEYAPERKLNRPE
DRALLRRAAGESVVLLKNDKNDSTNSPILPLDREKTTLVIGPNADLAAYCGGGSASLLAY
YTVTPRQGIADKCGAEQVVFSQGCYGHKELPLLGEHLRTIETGQPGYTFRVYTEPPPASG
SFKGSDSRTPVDELHMTNSSAFLMDYSHPQISGDTYYATLEGTFEPPESGVYEFGLTVAG
TGLLYIDGVLVVDNKTVQRAGTSFFGIGTVEERGERYLEAGKKHHVFVEFGTAPTSNLQH
HHGVVSFGPGGLRLGGCRKLDTDTAIQQAVQSAAQADQVVVCVGLSGDWESEGFDRPHMD
LPPGTDELVNAVLAVQPNAVIVVQSGTPVTMPWADKAKALLQAWYGGNEAGNGIADVLFG
DVNPSAKLPLTFPRELAQNPSYLSYRSERGRVLYSEDIYVGYRYYDTTGQPPLFRFGHGL
SYSTFHLRDLTVRETAPYAANIKESSLRVSVTVSNTSARPGAEVVLVYVRPPAAACSVGR
PVRELKGYEKVMLQPGETREVSITIPLGLATSFWDEGCDAWLSEKGLYFVEAVGTGEGNT
LVAPLTVQVSRVWNGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	40	237	4e-56	0.8842592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.35e-75	43	815	101	734	beta-glucosidase BglX.
224389	BglX	1.95e-63	34	376	48	390	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	8.73e-48	579	702	94	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.42e-38	11	805	51	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.90e-35	43	278	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58910.1|GH3	0.0	31	856	52	850
AJA36818.1|GH3	0.0	9	856	1	838
BCS04055.1|GH3	0.0	9	856	1	839
BCS15658.1|GH3	0.0	9	856	1	839
BAE61980.1|GH3	0.0	14	856	6	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.15e-241	9	856	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.69e-237	14	856	6	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.22e-130	14	830	5	651	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.49e-105	18	848	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	3.80e-95	16	826	56	807	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	0.0	14	856	6	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	0.0	9	856	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q5AV15|BGLJ_EMENI	0.0	31	856	52	850	Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglJ PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	0.0	9	856	1	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q4WLY1|BGLJ_ASPFU	0.0	1	856	1	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999996	0.000045

TMHMM  Annotations     

There is no transmembrane helices in Afu6g11910-T-p1.