CAZyme Information: Afu6g11610-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu6g11610-T-p1
• CAZy Family: GH76
• CAZyme Description: Putative cellobiohydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532		56457.21	4.5805

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr6_A_fumigatus_Af293:2878078-2879676(-)

Full Sequence      

MLASTFSYRMYKTALILAALLGSGQAQQVGTSQAEVHPSMTWQSCTAGGSCTTNNGKVVI
DANWRWVHKVGDYTNCYTGNTWDTTICPDDATCASNCALEGANYESTYGVTASGNSLRLN
FVTTSQQKNIGSRLYMMKDDSTYEMFKLLNQEFTFDVDVSNLPCGLNGALYFVAMDADGG
MSKYPTNKAGAKYGTGYCDSQCPRDLKFINGQANVEGWQPSSNDANAGTGNHGSCCAEMD
IWEANSISTAFTPHPCDTPGQVMCTGDACGGTYSSDRYGGTCDPDGCDFNSFRQGNKTFY
GPGMTVDTKSKFTVVTQFITDDGTSSGTLKEIKRFYVQNGKVIPNSESTWTGVSGNSITT
EYCTAQKSLFQDQNVFEKHGGLEGMGAALAQGMVLVMSLWDDHSANMLWLDSNYPTTASS
TTPGVARGTCDISSGVPADVEANHPDAYVVYSNIKVGPIGSTFNSGGSNPGGGTTTTTTT
QPTTTTTTAGNPGGTGVAQHYGQCGGIGWTGPTTCASPYTCQKLNDYYSQCL

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2	3.2.1.4:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	28	463	2.3e-202	0.9951807228915662
CBM1	500	528	6e-17	0.9655172413793104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395677	Glyco_hydro_7	0.0	29	462	1	434	Glycosyl hydrolase family 7.
153432	GH7_CBH_EG	0.0	34	457	1	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
197593	fCBD	3.27e-14	500	532	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	1.17e-13	500	528	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAL89006.1|CBM1|GH7	0.0	1	532	1	532
CAD79795.1|CBM1|GH7	0.0	1	532	1	532
EAW16381.1|CBM1|GH7|3.2.1.176	0.0	1	532	1	530
EAU34071.1|CBM1|GH7	0.0	7	532	4	541
AAW68437.2|CBM1|GH7	0.0	7	532	4	540

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4V1Z_A	0.0	28	466	2	440	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]
1Q9H_A	4.03e-258	28	465	2	436	Chain A, cellobiohydrolase I catalytic domain [Rasamsonia emersonii],3PFJ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFX_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFZ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PL3_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii]
4ZZT_A	1.94e-242	28	464	2	436	Geotrichum candidum Cel7A structure complex with thio-linked cellotriose at 1.56A [Geotrichum candidum],4ZZU_A Geotrichum candidum Cel7A structure complex with thio-linked cellotetraose at 1.4A [Geotrichum candidum],4ZZV_A Geotrichum candidum Cel7A apo structure at 1.4A [Geotrichum candidum],4ZZW_A Geotrichum candidum Cel7A structure complex with cellobiose at 1.5A [Geotrichum candidum],5AMP_A Geotrichum candidum Cel7A apo structure at 2.1A [Geotrichum candidum]
4ZZP_A	3.58e-231	28	465	2	438	Dictyostelium purpureum cellobiohydrolase Cel7A apo structure [Dictyostelium purpureum],4ZZP_B Dictyostelium purpureum cellobiohydrolase Cel7A apo structure [Dictyostelium purpureum]
4XEB_A	5.78e-227	28	466	2	436	The structure of P. funicolosum Cel7A [Talaromyces funiculosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNL0|CBHB_NEOFI	0.0	1	532	1	530	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=cbhB PE=3 SV=1
sp|Q4WM08|CBHB_ASPFU	0.0	1	532	1	532	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhB PE=1 SV=1
sp|B0Y8K2|CBHB_ASPFC	0.0	1	532	1	532	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=cbhB PE=3 SV=1
sp|Q0CMT2|CBHB_ASPTN	0.0	7	532	4	541	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhB PE=3 SV=1
sp|A1CU44|CBHB_ASPCL	2.07e-317	1	532	1	539	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=cbhB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000352	0.999649	CS pos: 26-27. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in Afu6g11610-T-p1.