CAZyme Information: Afu6g00550-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu6g00550-T-p1
• CAZy Family: GH55|GH55
• CAZyme Description: Glycosyl transferase family 8 family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	Chr6_A_fumigatus_Af293|CGC8	42828.50	5.4409

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr6_A_fumigatus_Af293:137231-138358(+)

Full Sequence      

MAVSFRWRPSPRATKALLISAFAILSLCTLWTLWYHVSSTFSAVSTPIGLHDSEGKLSDE
QRERPSPSGPETVPEKGPPRQHRYAFATILTGEDATETDIKDPYFTAVRLLAYQLLRSPH
TKSSSDIPFLVLVTEEVPQQQRDILSRDGAIVVPVEGFSRDWIHPKWERWKSVLAKLNLW
KLTEYEKITFLDADSVIFEPIDGIFTERATMTQITRPSSAALNTPGPVPDSYMMAGMHDR
WVEVALPPVPGSEFYAKDNYMNAGFFVLAPSEAMFKYYSFLLDQPGLFDPAYPEQNLLNY
AHRVDGQMPWQDIGPLWSQKGSSFEHYDPRLKSLHQKWWKTSYDQTFDERIANAMAELKD
YLGKQEEDTVQPRSP

Enzyme Prediction     

No EC number prediction in Afu6g00550-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	101	325	2e-25	0.7704280155642024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.14e-28	84	299	1	164	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	2.07e-15	12	339	8	336	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
215090	PLN00176	6.76e-07	122	299	48	220	galactinol synthase
279798	Glyco_transf_8	3.91e-06	111	299	17	201	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133064	GT8_GNT1	7.52e-04	170	206	77	113	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE62267.1|GT8	1.33e-119	7	362	7	366
QMW44321.1|GT8	2.68e-119	7	362	7	366
UDD57256.1|GT8	2.17e-118	6	362	6	366
QMW32290.1|GT8	1.24e-117	6	362	6	366
QRD83739.1|GT8	1.24e-117	6	362	6	366

PDB Hits     

Afu6g00550-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43061|MU136_SCHPO	3.94e-22	83	365	56	366	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|Q09680|YA0C_SCHPO	4.63e-17	83	339	68	340	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|O43062|YGT9_SCHPO	9.76e-16	83	354	74	358	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|Q947G8|GOLS1_SOLLC	3.61e-12	122	369	45	305	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|Q9XGN4|GOLS1_AJURE	1.11e-07	122	356	48	305	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000002	0.000001

TMHMM  Annotations     

Start	End
13	35