CAZyme Information: Afu6g00520-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu6g00520-T-p1
• CAZy Family: PL4
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN11144, AN8627, AN11697, A. fumigatus Af293 : Afu8g07260, A. niger CBS 513.88 : An09g01560, An12g10160 and A. oryzae RIB40 : AO090003001375, AO090701000504, AO090102000039

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		49809.88	5.2814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr6_A_fumigatus_Af293:127197-128567(+)

Full Sequence      

MPLFQSWTRPPSRRIYLILVSPVIGLLLVYLFFAFDTDAFTPKVVVTPISPQQKQATCPQ
LGGIEDVLVILKTGVTEALEKVPVHFQTTLRCIPNYVLFSDFEEEINGTRVIDVLGNVNE
TIKRTSPDFDLYNRIHEHGRSGLTPADLSRVPNTAFGMPDNPGWKLDKWKFLPMIDETLR
VRDDAKWYVFMEADTYYIWSNLLQWLAQLDPTKPYYLGNPTQIGSDIFGHGGSGFILSRE
AMRRASDLRAKDLDGWDRYTGEQWAGDCVLGKLLHDAGVPLLWSWPMLQSNTPAEFDHFS
EAYSKKPWCFPAVSYHHVGPEDIQELMKFDQMFMQNNSVILHSDVFRHLVHPQLKSPQPD
WDNLSDEEHLIDAASCQEMCASEPDCLQYSYEAGKCRTSKMAKIGVPKTGVSSGWMTDRI
DAIVKELGSCTKPQWVLP

Enzyme Prediction     

No EC number prediction in Afu6g00520-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	0.001	183	290	83	203	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	0.004	184	281	210	309	hypothetical protein; Provisional
238533	APPLE_Factor_XI_like	0.006	372	414	26	70	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW28702.1|GT31	3.03e-171	1	437	1	438
QRD83231.1|GT31	3.03e-171	1	437	1	438
UDD56757.1|GT31	3.03e-171	1	437	1	438
BAE58433.1|GT31	4.29e-171	1	437	1	438
QMW40773.1|GT31	1.74e-170	1	437	1	438

PDB Hits     

Afu6g00520-T-p1 has no PDB hit.

Swiss-Prot Hits     

Afu6g00520-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999953	0.000062

TMHMM  Annotations     

Start	End
13	35