CAZyme Information: Afu5g14090-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu5g14090-T-p1
• CAZy Family: GH53
• CAZyme Description: Has domain(s) with predicted catalytic activity, hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
976	Chr5_A_fumigatus_Af293|CGC11	109325.94	5.8665

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr5_A_fumigatus_Af293:3682333-3685263(-)

Full Sequence      

MGWQSRMIQSKALIDICDIFTMRESILSVLTFFSLLLVVQARDDGRMKYNFNSGWKVLVG
NPASAQSPSFNDNDWKDVTLPHAWNEDDAFRVDIANLSTGIAWYRKHFDLPATSRNKKVF
LEFEGIRHAGEFYLNGKWIGRSENGVMAFGFDVSDITLYNQTNVLAAQIDNSWTYREKAT
STPYQWNDKNFYANYGGINKNVFLHVTDRLYQTLPLYSNLQTTGVYIYATDLDIPRKSAT
INVESQVRNEYQQARTFQYQVDIHDAVQGKKLKTITGGRYTLQANETRTIRTTTHLSDLN
FWSWGYGYLYDVRTSLLLNHHAIDSVKTRTGFRKTEFTHGAFKLNDRTLHLKGYAQRTTN
EWPALGCAVPPWLTDFSNSLVLASNAALIRWMHVTPWKQDVESLDRLGLLQALPAGDSEG
DATGRRWAQRTELMRDAVIYHRNSPSVIFYEAGNHGISEAHMSEMKALRDTYDPHGGRAA
GSREMLNSSVAEYGGEMLYINKGARIRLWQMEYSRDEGLRKYWDDWSPPYHVDGAGPPYK
GEDASEYNRNQDSHAVENVRRWFDYFEQRPGTGTRVNAGGVNIIFSDSNTHHRGAENYRR
SGEVDGVRLPKDGWYAHKVMWDSWVDVDRLAGHIIGHWNYNDTTVKDFYVVSTAEEVELF
LNGKSVGKGEQSSRFLFTFANVTWQPGTIRAVGRLDARESLLDTKTTAGEPASIRLTPHT
GPSGFVADGADIAVVDVEVVDAEGQRNPIALNIIDFALSGEASWRGGIAQCADNCILSTT
LPVENGINRVMLRSTTRAGQVTLTATSDGLKPATISLNTKPFASKGGLSTVIPGSDLPFV
LSRGPTPSSESYTISRKAVEGLNVTAGCDTENMINSYDDDEETEWSCDGDKSSTWIKYSW
DSPVNVSQMVMKLHSFRTTKYPVQISVDDTVVYEGVTPTSLGYVTLDLNATVGQSVTVAS
EDSDLGIIEAEIYTPA

Enzyme Prediction     

EC	3.2.1.31:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	43	488	3.3e-60	0.4920212765957447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	9.63e-22	50	640	29	615	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	1.10e-15	32	353	21	338	cryptic beta-D-galactosidase subunit alpha; Reviewed
236657	PRK10150	1.84e-15	100	354	65	297	beta-D-glucuronidase; Provisional
406696	DUF4982	5.00e-13	644	699	2	58	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.
397120	Glyco_hydro_2_N	1.06e-11	78	154	34	119	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCM93650.1|GH2	0.0	46	975	40	1000
BBB61369.1|GH2	0.0	46	972	4	933
QEK53149.1|GH2	0.0	31	972	16	958
ALW85295.1|GH2	0.0	37	958	24	946
QNA42647.1|GH2	0.0	46	975	21	980

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	1.49e-160	46	847	35	831	The structure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
7CWD_A	8.18e-55	48	825	3	807	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	9.73e-51	44	819	5	807	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	1.16e-44	50	820	29	821	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
6B6L_A	7.21e-37	50	817	9	775	The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KN75|PLH17_FORAG	6.07e-160	46	847	26	822	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|A7LXS9|BGH2A_BACO1	1.70e-44	46	820	42	849	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|P77989|BGAL_THEP3	3.68e-33	45	820	2	739	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|T2KPJ7|PLH8_FORAG	4.10e-30	44	703	49	714	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|T2KM09|PLH16_FORAG	9.29e-29	35	761	35	759	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.417746	0.582252	CS pos: 41-42. Pr: 0.5254

TMHMM  Annotations     

Start	End
19	41