CAZyme Information: Afu5g03980-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu5g03980-T-p1
• CAZy Family: GT90
• CAZyme Description: Has domain(s) with predicted role in cell wall macromolecule catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	Chr5_A_fumigatus_Af293|CGC18	37149.56	4.0031

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr5_A_fumigatus_Af293:1062766-1063902(+)

Full Sequence      

MMKSIRFLASALALCLVDAYLVTPPGTPAPGAASACSAWVQASYGLTCDIIHRFYGMTAA
EFEEWNPSVSQLGDGCTLISGLYYCVQVNYITQSPTWTPPTTTTRSTSSSAGNGVTTPTP
TQTGMVSSCNRFYLVVSGDSCYDIAAAQGISLDNFYTWNPAVGSSCGGLWPDYYVCVGVI
SDGTTTTTTTTTTPTTTSTTTTTAGNGVTTPTPIQTGMVTNCNKFYQVVSGDGCYDIAAA
AGIALNDFYTWNPAVGNTCAGLWPDYYVCVGIIGSSGTTTTKTTTTTTSGNGVATPTPTQ
SGMVSNCKKFYLVVSGDGCYDIAAAAGIALSDFYAWNPAVGDTCAGLWPNYYVCVGI

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	4.54e-09	131	175	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.72e-08	309	353	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.92e-08	224	268	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
180536	PRK06347	5.29e-07	112	343	310	514	1,4-beta-N-acetylmuramoylhydrolase.
197609	LysM	2.90e-06	132	177	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ53591.1|CBM50	1.23e-136	2	357	1	355
UKZ79391.1|CBM50	6.26e-121	2	357	1	342
QYT04780.1|CBM50	9.82e-94	11	357	6	335
CCF37665.1|CBM50	5.02e-88	22	319	24	314
ATY65640.1|CBM50	2.31e-84	22	356	458	779

PDB Hits     

Afu5g03980-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	4.32e-71	30	356	149	456	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B5F9|PGDA_ARTBC	4.64e-19	121	179	379	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4B4P8|LYSM2_ARTBC	9.88e-15	36	179	29	181	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AVW3|LYSM5_ARTBC	3.64e-14	112	357	241	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4AY86|LYSM6_ARTBC	3.83e-08	118	177	360	419	LysM domain-containing protein ARB_01155/01156 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01155/01156 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999760	CS pos: 19-20. Pr: 0.9408

TMHMM  Annotations     

There is no transmembrane helices in Afu5g03980-T-p1.