CAZyme Information: Afu5g01405-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu5g01405-T-p1
• CAZy Family: GT90
• CAZyme Description: Has domain(s) with predicted role in cell wall macromolecule catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	Chr5_A_fumigatus_Af293|CGC25	37953.68	4.2970

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr5_A_fumigatus_Af293:355133-356443(-)

Full Sequence      

MILPPFPLVSPITIDWPAYQTTIASSSGGTTLTKTTTITVAPFTISEIPFWPITVAEPGR
NAYLSPMQSIAPPTFGLTLPPTEATFPLFHTDYSATLTTTASTANATVPSVSTPAAVQSG
IVSDCTEFYKAIAGDGCYAIATAHDITLAQFIAWNPAVNSDCSGLWVDEYYCVAVAKATS
TTSYTPIPVTFFGNSHVITVAPQPTATSIQPPGTSMPILTYSDGKTPSNGGCSSGGETTG
CGKIDCSLFGCGGECGFFGCDGGCGLGFCGGGCGLLGCGPGCGSGSCLQEGGGGGSEEEE
TSTSESCSATATASVTIVCDYACPDGASTSCAILCTSLTISCEPTGLVRSHRALWTQTRC
HSHYLRPPMRP

Enzyme Prediction     

No EC number prediction in Afu5g01405-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	6.61e-08	128	166	2	40	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	9.80e-06	128	173	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS08616.1|CBM18|CBM50|GH18	4.65e-172	1	348	525	872
BCR96098.1|CBM18|CBM50|GH18	4.65e-172	1	348	525	872
BCS04473.1|CBM18|CBM50|GH18	2.55e-60	1	347	525	901
BCS16058.1|CBM18|CBM50|GH18	2.55e-60	1	347	525	901
UKZ48133.1|CBM18|CBM50|GH18	6.08e-32	1	253	888	1123

PDB Hits     

Afu5g01405-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	3.71e-12	111	175	229	293	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B5F9|PGDA_ARTBC	6.31e-09	118	175	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4B4P8|LYSM2_ARTBC	8.90e-09	59	186	70	192	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AY86|LYSM6_ARTBC	9.52e-07	114	174	360	420	LysM domain-containing protein ARB_01155/01156 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01155/01156 PE=3 SV=2
sp|D4B4Q2|LYSM4_ARTBC	3.72e-06	118	174	303	359	LysM domain-containing protein ARB_03442 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03442 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995390	0.004641

TMHMM  Annotations     

There is no transmembrane helices in Afu5g01405-T-p1.