CAZyme Information: Afu4g11280-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu4g11280-T-p1
• CAZy Family: GH3
• CAZyme Description: Ortholog(s) have dolichyl-phosphate-mannose-glycolipid alpha-mannosyltransferase activity and role in GPI anchor biosynthetic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470	Chr4_A_fumigatus_Af293|CGC13	51435.68	9.6793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr4_A_fumigatus_Af293:2952812-2954348(+)

Full Sequence      

MSRMTVLSPSAGSQSACSLGLILVNPRRPLRSLSILFGLWKALIFLVIVICPGLGYDTST
SLLLYPTRDLSDVDPLHFPLSLRFVRWDSIYFVHAAEHGYVFEQEWAFGYGYTRLLALLA
SVFPRSASLGDSARIGLVAVVLSHIAHYLSVLVLYRLSVNIFGGDTAKQKTLCFLSAALH
IISPAGAFLSAPYGEALFSLLNISGLYLYSSSVLDAATNHRLSRDLKLLAAAVLISAATA
VRSNGILGGVLFAYDALLQLPQILSRGLSLAVVSRLAVIVLGGCVIALGMAVPQYIAFNA
FCMTSNAPRPWCGWTIPSIYRFVQEKYWNVGFLRYWVVPNIPLFLLAMPILALLLRSAFW
AWRLPSVTSKFSENGANGALTKAMWLLPRLAIIQALLAVLAFTSYHVQIINRLSSGYPLW
YWYLAAELISDFKNSQSTNKCISISAVAVQAIMIYGLIHAVLFGSFLPPA

Enzyme Prediction     

No EC number prediction in Afu4g11280-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	36	470	3.9e-112	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.41e-40	33	470	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.51e-20	79	470	69	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01167.1|GT76	6.84e-176	23	470	15	469
BCS12914.1|GT76	6.84e-176	23	470	15	469
CAK38795.1|GT76	1.89e-172	23	470	15	466
QMW40534.1|GT76	3.10e-170	23	470	12	452
BCR82784.1|GT76	4.86e-170	23	470	14	465

PDB Hits     

Afu4g11280-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WQ21|GPI18_ASPFU	4.03e-307	1	470	1	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	5.98e-161	23	470	12	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	5.10e-88	29	470	18	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	7.92e-87	28	470	9	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.12e-50	32	470	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999955	0.000056

TMHMM  Annotations     

Start	End
34	56
137	159
172	194
276	298
332	354
385	407
441	463