CAZyme Information: Afu4g00430-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu4g00430-T-p1
• CAZy Family: GH27
• CAZyme Description: Has domain(s) with predicted UDP-N-acetylmuramate dehydrogenase activity, flavin adenine dinucleotide binding, oxidoreductase activity and role in oxidation-reduction process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635	Chr4_A_fumigatus_Af293|CGC23	69544.40	6.6633

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr4_A_fumigatus_Af293:111425-113570(-)

Full Sequence      

MTHYVSLIHQTLCDSAVEYERTDGDADQPASDAFQLNDRSDRLLCLVLYFLVDLLNVSEY
EGQAVRISNSSCRCRPHEPCWPSPQEWNALNSSVDGNLFAVRPVAAPCHEGDSEACDLVT
KQWYNSTWRAAQPGAVQWENWDSWLEHNQTCSIINPQGPCGQGRVSLYSVVAEKASHIQE
AVRFAKRHNLRLAIKNSGHDFLGRSTAPQSLQILTNGMKDIHFSDNFRPSGAPSNISEGS
AITIGAGVSLQELYPAAGKKGKTVVAGLSHTVGAAGGYIQGGGHSFLGPWKGMSTDNVLE
YTVVAATGHLVIANNYRNTDLFWALRGGGGGTFGVVVAVTLRTFDEVPVVFGNLNVSTMA
GDPNFWQVMTDFHAALPAINDHAGGYYWMTPNMPVDKTLNVSSLSIILMAANQSSTAMMD
RLFAPFRSKLNETSGVFTEYESLAFPDIHTLLSDLLLPAREDQTGHNTILGSRLFSHDLL
VSSDGPKKLVSALQKIKFDPGQGITGHIVAGGLVTKNGRTIDSALNPAWRKAATHIDFGR
AWPPSATLAQRDAIIRRLTDVEMPILKAVEGKKMGSYMNEANAYEPDFQTEFWGSNYPRL
YRIKQKWDPSGLFIARKGVGSEDWDDAGLCRVHRK

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	170	377	2.3e-46	0.40829694323144106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	2.40e-20	170	314	5	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	5.17e-11	576	620	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
223354	GlcD	1.04e-09	178	613	44	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	4.49e-48	61	625	489	1055
QKD57322.1|CBM91|GH43_11	4.49e-48	61	625	489	1055
UQC87672.1|AA7	4.35e-17	170	621	74	497
CAE7214923.1|AA7	1.71e-15	171	621	68	491
QRC92907.1|AA7	2.11e-13	171	621	68	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	5.35e-79	54	632	5	574	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	1.92e-57	72	631	30	597	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
4PVK_A	1.97e-17	167	350	54	229	Phl p 4 I153V N158H variant, a glucose oxidase [Phleum pratense],4PWC_A Phl p 4 I153V N158H variant, a glucose oxidase, 3.5 M NaBr soak [Phleum pratense]
4PVH_A	2.61e-17	167	350	54	229	Phl p 4 N158H variant, a glucose dehydrogenase [Phleum pratense]
4PVJ_A	6.12e-17	167	350	54	229	Phl p 4 I153V variant, a glucose oxidase [Phleum pratense],4PWB_A Phl p 4 I153V variant, a glucose oxidase, pressurized with Xenon [Phleum pratense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AS41|A7056_ARTBC	1.00e-189	72	632	26	588	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07056 PE=1 SV=2
sp|L0E159|MALF_MALAU	2.56e-140	72	630	25	576	FAD-linked oxidoreductase malF OS=Malbranchea aurantiaca OX=78605 GN=malF PE=1 SV=1
sp|Q5AR49|ASQF_EMENI	2.46e-130	72	632	26	575	FAD-linked oxidoreductase asqF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=asqH PE=3 SV=1
sp|A0A1B2CTB4|PENH_PENTH	1.78e-123	71	632	28	574	FAD-linked oxidoreductase penH OS=Penicillium thymicola OX=293382 GN=penH PE=1 SV=1
sp|W6R4D7|IFGC_PENRF	2.26e-123	70	635	26	604	FAD-linked oxidoreductase ifgC OS=Penicillium roqueforti (strain FM164) OX=1365484 GN=ifgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999909	0.000091

TMHMM  Annotations     

There is no transmembrane helices in Afu4g00430-T-p1.