CAZyme Information: Afu3g10850-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu3g10850-T-p1
• CAZy Family: GH18
• CAZyme Description: Ortholog of A. niger CBS 513.88 : An16g00500, A. oryzae RIB40 : AO090102000071, Neosartorya fischeri NRRL 181 : NFIA_032600 and Aspergillus wentii : Aspwe1_0045718

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445		50962.34	7.9967

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr3_A_fumigatus_Af293:2824168-2825505(-)

Full Sequence      

MGRCLTYQPCQLLILGLVAALAFSIWTLWLGVNSDKDNIHPLLNQLIPAGHCACRSATIF
SCDSCLQCSASTLPPSPSPPHITFDPNEYSYNETQCHSFFPGLFEDPTRAQTFWQAKNGI
RRADLDNVQMMNGMVRAAVYKGRLYVLTALARGEDHRRKIIGVLSSIHRALISASDLAVI
PDTEFIFSVEDKVEDIAGPGHPLWVLARKPHEESVWLMPDFGFWSWGHLDSQIRPYDQVV
EHVRQREVPWDQKRDKLVWRGKLSFAPKLRRTLLEVARGYPWGDVREVEWRNKANFLSME
EHCDYKFIAHVEGRSYSASLKYRQACQSVVVIHKLQYIQHHHYLLVSSGPQQNFVQVERD
FSDLPQKMQELLDNPAKAQRIARNSVNVFRERYLTAAADACYWRALLLAWAVASPDLTLR
GPPQNGIRYESFLLLGESNMMHFGR

Enzyme Prediction     

No EC number prediction in Afu3g10850-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	180	411	6.3e-20	0.972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.07e-22	180	411	2	250	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.96e-20	95	411	5	320	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW35140.1|GT0	3.89e-244	1	444	1	454
QRD91520.1|GT0	3.89e-244	1	444	1	454
QMW31874.1|GT0	9.52e-205	21	443	23	454
QRD90937.1|GT0	9.52e-205	21	443	23	454
UDD60835.1|GT0	5.48e-204	21	443	23	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	3.79e-08	177	407	125	372	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T045|RUMI_DROME	2.00e-07	177	407	137	384	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	8.18e-07	177	410	135	385	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000006

TMHMM  Annotations     

Start	End
13	32