CAZyme Information: Afu3g02040-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu3g02040-T-p1
• CAZy Family: GH16
• CAZyme Description: Has domain(s) with predicted catalytic activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510		55544.05	4.7433

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr3_A_fumigatus_Af293:500884-502712(+)

Full Sequence      

MAYVGSTRGGPIIGDSAHSKASAIKMFTHPAPQPSNSDALLNLLISENIAMRLQSLPRLG
WNALWTTLIFSSLAQAIDVDINDDQSIKNAASTAAYGAMSYYHGNESGQIPGAFPTKWWE
GSALFMAMLQYQYFTGDHTYNSDVSLGLQWQAGDGDYMPSNYSSYLGNDDQMFWGLAAML
AAELQFPDRSEGYSWLSLAQGVYNTQVDRWDTSTCGGGLRWQIYTYQAGYTMKNAISNGG
LFQLAARLARYTNNHTYYEWAEKVWDWSCSSPLLNNKTWSVADSTNIEDGCESQGNNQWS
YNYGTYLMGAAYMWNYTNGTNSKWATAVDGLLNNTLDIFFPAKYGGNIMSEVLCEPNEVC
NDNEILFKGLVTSWLAFTALLVPSTYDRILPKLQGSAVAAGATCTGNGNNSCGVRWYTSK
WDGWTGMEEQISVTDVLSVSLITTKHKGPVTSTTGGNSTSNPTAGSGDKSGQTTPTRKIT
MGDKAGASILTIGLVVGWVSLIAFMIIGGK

Enzyme Prediction     

No EC number prediction in Afu3g02040-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	85	451	4.9e-96	0.9581005586592178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	9.04e-180	86	433	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	0.005	161	307	82	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65580.1|GH76	4.18e-230	73	508	21	455
CAK47058.1|GH76	5.93e-230	75	508	21	456
CAK46589.1|GH76	8.73e-230	67	509	16	457
BCS03764.1|GH76	1.15e-229	75	508	21	455
BCS15380.1|GH76	1.15e-229	75	508	21	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	5.74e-88	81	484	30	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	5.30e-103	68	491	13	433	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	2.68e-101	67	465	11	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	5.12e-101	69	491	11	436	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	5.30e-99	77	491	19	430	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	2.92e-97	81	491	24	426	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999346	0.000663

TMHMM  Annotations     

Start	End
487	509