CAZyme Information: Afu3g00610-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu3g00610-T-p1
• CAZy Family: GH15
• CAZyme Description: Has domain(s) with predicted catalytic activity, glucan 1,4-alpha-glucosidase activity, hydrolase activity, hydrolyzing O-glycosyl compounds, starch binding activity and role in polysaccharide metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619		67029.03	4.8015

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr3_A_fumigatus_Af293:139329-141306(+)

Full Sequence      

MRFAGIACIASVLGHLATPSSAKELAARSPAAANSRLVKEGLFAYESILAALGNTGINAP
GTAAGLLIASPTIQNPDYFYTWTRDAALTFKGLVDIFIGGDTFIVVNLDGLETHIQDYIS
SQAVLQNVSNPSGRLSDGSGLGEPKFEVNFNPYSGGWGRPQRDGPALRAITMLTYIRQLI
QQGKQSVASNLIWPVVANDLTYVAQYWNHTGFDLWEEIDGSSFFTTAVQHRAMVEGSAIA
QALGKPHAGYDAVAPEILCLLQSYWNESAIISNINVNNGRSGIDLNSVLTSIHTFDPAAG
CDDSTFQPCSSKALANHKVYVDSFRSIYGINAGLGPGKAANVGRYAEDVYQGGNPWYLAT
LAAAEQLYDALYQWKKQGYLTVTQTSLAFFRDFSSTVEPGTYKSNTPTYKSLTDYVRTYA
DDFFFLVEKYTPSNGSLAEQYDRNTGVPLSANDLTWSYAAFLSTLQRRLNIMPDSWGPSS
ANPVPTTCSKTTITGTYSAVAPPFPTSTAQCVAAVTVPVTFWLIENTYYGENVYMTGNVS
ALGDWNASAGYSLNAGLYTSDENLWFATVKGLEPGVTMEYKFYKIEPGNSVTFEGGENRV
YAVPTACPVAPQVHAVWQT

Enzyme Prediction     

EC	3.2.1.3:94	3.2.1.1:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	49	463	2.7e-74	0.9778393351800554
CBM20	517	606	6.8e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395586	Glyco_hydro_15	6.59e-130	46	464	5	415	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
99886	CBM20_glucoamylase	1.33e-41	511	617	1	106	Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain. Glucoamylases are inverting, exo-acting starch hydrolases that hydrolyze starch and related polysaccharides by releasing the nonreducing end glucose. They are mainly active on alpha-1,4-glycosidic bonds but also have some activity towards 1,6-glycosidic bonds occurring in natural oligosaccharides. The ability of glucoamylases to cleave 1-6-glycosidic binds is called "debranching activity" and is of importance in industrial applications, where complete degradation of starch to glucose is needed. Most glucoamylases are multidomain proteins containing an N-terminal catalytic domain, a C-terminal CBM20 domain, and a highly O-glycosylated linker region that connects the two. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
395557	CBM_20	1.76e-31	517	613	1	95	Starch binding domain.
215006	CBM_2	6.72e-25	517	605	1	88	Starch binding domain.
119437	CBM20	9.95e-22	519	607	2	88	The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EPS30575.1|CBM20|GH15|3.2.1.3	4.46e-271	39	619	36	616
QGA19176.1|CBM20|GH15	2.01e-215	21	618	19	616
APM84499.1|CBM20|GH15	8.11e-215	24	618	22	616
APA12357.1|CBM20|GH15	3.44e-214	34	619	70	679
QPC79615.1|CBM20|GH15	5.96e-214	40	619	63	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FHV_A	5.68e-272	39	618	14	593	Crystal structure of Penicillium oxalicum Glucoamylase [Penicillium oxalicum 114-2]
2VN4_A	5.43e-212	44	619	13	599	Chain A, GLUCOAMYLASE [Trichoderma reesei],2VN7_A Chain A, GLUCOAMYLASE [Trichoderma reesei]
6FRV_A	4.41e-205	34	607	4	604	Structure of the catalytic domain of Aspergillus niger Glucoamylase [Aspergillus niger]
3EQA_A	4.03e-184	34	500	4	461	Catalytic domain of glucoamylase from aspergillus niger complexed with tris and glycerol [Aspergillus niger]
6FHW_A	1.43e-182	34	617	32	606	Chain A, Glucoamylase P [Amorphotheca resinae],6FHW_B Chain B, Glucoamylase P [Amorphotheca resinae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P69327|AMYG_ASPAW	5.11e-204	34	607	28	628	Glucoamylase OS=Aspergillus awamori OX=105351 GN=GLAA PE=1 SV=1
sp|P69328|AMYG_ASPNG	5.11e-204	34	607	28	628	Glucoamylase OS=Aspergillus niger OX=5061 GN=GLAA PE=1 SV=1
sp|P14804|AMYG_NEUCR	2.57e-203	34	618	38	626	Glucoamylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gla-1 PE=1 SV=3
sp|P22832|AMYG_ASPUS	2.60e-201	34	607	28	627	Glucoamylase OS=Aspergillus usamii OX=186680 GN=glaA PE=3 SV=1
sp|P23176|AMYG_ASPKA	1.48e-200	34	607	28	627	Glucoamylase I OS=Aspergillus kawachii OX=1069201 GN=gaI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000394	0.999591	CS pos: 22-23. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in Afu3g00610-T-p1.