CAZyme Information: Afu3g00470-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu3g00470-T-p1
• CAZy Family: GH15
• CAZyme Description: Has domain(s) with predicted cellulose binding, hydrolase activity, hydrolyzing O-glycosyl compounds activity, role in carbohydrate metabolic process and extracellular region localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	Chr3_A_fumigatus_Af293|CGC3	29697.90	5.4771

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr3_A_fumigatus_Af293:100611-101583(-)

Full Sequence      

MISISSLSFGLAAIAGAYALPSDKSVSLAERQTITTSQTGTNNGYYYSFWTNGAGSVQYT
NGAGGEYSVTWANQNGGDFTCGKGWNPGSDHDITFSGSFNPSGNAYLSVYGWTTNPLVEY
YILENYGSYNPGSGMTHKGTVTSDGSTYDIYEHQQVNQPSIVGTATFNQYWSIRQNKRSS
GTVTTANHFKAWASLGMNLGTHNYQIVSTEGYESSGTSTITVSSGGSSSGGSGGSSSTTS
SGSSPTGGSGSCSALWGQCGGIGWSGPTCCSSGTCQVSNSYYSQCL

Enzyme Prediction     

EC	3.2.1.8:67

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	43	221	1.9e-74	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	7.24e-106	43	219	1	175	Glycosyl hydrolases family 11.
197593	fCBD	1.99e-10	254	286	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	1.17e-09	255	282	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV23009.1|GH11|3.2.1.8	1.05e-163	1	229	1	229
AGW24301.1|CBM1|GH11	1.04e-139	1	286	1	310
ADX86897.1|CBM1|GH11	1.04e-139	1	286	1	310
ADV31286.1|CBM1|GH11|3.2.1.8	1.04e-139	1	286	1	310
ACP27609.1|GH11	1.32e-131	1	230	1	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TE1_B	1.32e-103	32	223	1	190	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
3WP3_A	1.67e-103	28	223	14	207	Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus],3WP3_B Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus]
5HXV_A	9.60e-99	34	223	3	190	Chain A, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_B Chain B, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_C Chain C, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_D Chain D, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_E Chain E, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_F Chain F, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_G Chain G, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_H Chain H, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_I Chain I, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_J Chain J, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_K Chain K, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_L Chain L, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612]
4XPV_A	4.56e-87	39	223	6	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQ4_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQ4_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],6JXL_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],6K9O_A Crystal Structure Analysis of Protein [Trichoderma reesei RUT C-30],6KWD_A Crystal Structure Analysis of Endo-beta-1,4-Xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30]
6KVV_A	4.72e-87	39	223	7	190	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei RUT C-30],6KW9_A Crystal Structure Analysis of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],6KWF_A Crystal Structure Analysis of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E7EF85|XYNB_PENOX	1.85e-140	1	286	1	310	Endo-1,4-beta-xylanase B OS=Penicillium oxalicum OX=69781 GN=xynB PE=1 SV=1
sp|B7SIW1|XYNB_PHACH	3.89e-116	1	286	1	290	Endo-1,4-beta-xylanase B OS=Phanerodontia chrysosporium OX=2822231 GN=xynB PE=1 SV=1
sp|W0HJ53|XYN2_RHIOR	1.03e-110	1	223	1	216	Endo-1,4-beta-xylanase 2 OS=Rhizopus oryzae OX=64495 GN=xyn2 PE=1 SV=1
sp|Q9HFH0|XYNC_TALFU	4.51e-104	28	223	30	223	Endo-1,4-beta-xylanase C OS=Talaromyces funiculosus OX=28572 GN=xynC PE=1 SV=1
sp|Q2PGY1|XYNA_PENCI	3.78e-99	1	223	1	217	Endo-1,4-beta-xylanase A OS=Penicillium citrinum OX=5077 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000350	0.999604	CS pos: 19-20. Pr: 0.9522

TMHMM  Annotations     

There is no transmembrane helices in Afu3g00470-T-p1.