CAZyme Information: Afu3g00340-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu3g00340-T-p1
• CAZy Family: GH13|GH13
• CAZyme Description: putative glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	Chr3_A_fumigatus_Af293|CGC8	50245.74	4.8548

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr3_A_fumigatus_Af293:71186-72734(+)

Full Sequence      

MRMLSLRQLCGATTLLLSGQVALADLGIQADNVDSLKSAAKTVAAPMMDFYDKNQTEGIP
GKLTGTWYVAGAMFMTLIQYWQSSGDDTYNSIVSHDLMFQSGENYDFFSGNYSQWLGNDD
QMFWGLASITASETGFPEISGKPTWTSLARVVFNMQVARWDKVACDGGMRWQIWPYQAGY
TMKNAISNGGLFELSARLARFTKNETYAEWANKIWDWSASTPLLQTDRWYIADSTSNEAN
CKDAGNTQWSYNYGTYLSGASFMYNYTNGEDKWLKRVNGLLDSLIGTFCPKDKGGNVLSE
VACEPIMTCDRNQIGFKGYTAMWLAHTAILVPSTAARIFPVLQGSALALSKQCSKAPDNT
CGVRWWQPTWDGFTPGLETQMAALAGITANLMYYKSSAPKTIQSNPDGKEHQIDTHEDEA
PDALAPINTGDRAGAWILTVIIVVAVGGSVGWLIKT

Enzyme Prediction     

No EC number prediction in Afu3g00340-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	401	8.2e-98	0.9664804469273743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.21e-179	35	384	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48345.1|GH76	2.21e-256	1	456	1	457
QRD92720.1|GH76	2.21e-256	1	456	1	457
QMW36289.1|GH76	2.21e-256	1	456	1	457
UDD65548.1|GH76	2.21e-256	1	456	1	457
BAE66452.1|GH76	3.14e-256	1	456	1	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	8.24e-82	31	432	31	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	1.31e-89	26	392	20	385	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	4.58e-88	16	454	6	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	1.40e-87	31	454	27	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q5AD78|DCW1_CANAL	3.70e-85	28	454	21	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q9P6I3|YHG7_SCHPO	1.21e-83	34	439	28	426	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000625	0.999345	CS pos: 24-25. Pr: 0.9749

TMHMM  Annotations     

Start	End
432	454