CAZyme Information: Afu2g14420-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu2g14420-T-p1
• CAZy Family: GH125
• CAZyme Description: Putative cutinase with a predicted role in cutin degradation

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	Chr2_A_fumigatus_Af293|CGC33	34403.81	8.8162

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr2_A_fumigatus_Af293:3773901-3775028(-)

Full Sequence      

MKISATAVVLLAGLAAGAPTKTIQSKFEKRQFGTGTDGLGALASLFPTLGGGGSSTSSGL
GALASLIPGLGGSSSGSGFSLPGFTLPTSIPGLGSLGSLGSSGSSGASGLSGLSGLSGLS
GLSGLGGLSGLNGLGSSTTGSSAEASTSGTAATSSNSNSGGALFGLLGDHVAKRGLLGSM
TENGVKNKDACQPLTFIFARGTSELGNMGSVVGPPVATKLRSLLNNKVVVQGVDYPASVE
GNALLGAAGGPTMASMVKQALSQCPDTKVVVGGYSQGAMVVHNAANSLSQGQIAAAVLFG
DPFKSQAVGKVDKANVKEYCAAGDPVCLNGANVIAHLSYGSDAAEAAQFLVTASGVKA

Enzyme Prediction     

No EC number prediction in Afu2g14420-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	190	352	5.5e-43	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.08e-44	190	351	1	170	Cutinase.
223477	YpfH	3.74e-04	245	358	75	179	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89623.1|CE5	1.12e-86	181	356	103	278
QQK39777.1|CE5	1.28e-82	177	355	97	275
CAP91879.1|CE5	3.12e-81	178	355	144	321
BAE58644.1|CE5	8.74e-79	182	356	36	210
QRD85183.1|CE5	1.16e-78	179	356	150	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	1.58e-35	179	351	72	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	1.81e-28	191	355	21	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	1.43e-27	191	352	12	185	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	3.67e-22	191	350	23	194	Chain A, cutinase [Malbranchea cinnamomea]
5AJH_A	1.67e-20	174	351	14	206	Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_B Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_C Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	4.37e-77	176	356	45	223	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	1.12e-39	190	356	30	202	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|A8QPD8|CUTI1_TRIHA	3.22e-37	179	350	72	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	1.35e-36	190	355	30	200	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|G0RH85|CUTI1_HYPJQ	7.00e-35	179	351	72	244	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002235	0.997759	CS pos: 30-31. Pr: 0.4105

TMHMM  Annotations     

There is no transmembrane helices in Afu2g14420-T-p1.