CAZyme Information: Afu2g09380-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu2g09380-T-p1
• CAZy Family: GH1
• CAZyme Description: Putative cutinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
211		21856.20	7.5578

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr2_A_fumigatus_Af293:2401402-2402192(+)

Full Sequence      

MKFALLSLAAMAVASPVAIDVRQTAITGDELRTGPCEPITFIFARGSTEPGLLGITTGPG
VCNALKLSRPGQVACQGVGPAYIADLASNFLPQGTSQVAIDEAAGLFKLAASKCPDTKIV
AGGYSQGAAVMHGAIRNLPSNVQNMIKGVVLFGDTRNKQDGGRIPNFPTDRTKIYCAFGD
LVCDGTLIITPAHLSYGDDVPSATSFLLSKV

Enzyme Prediction     

EC	3.1.1.74:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	35	210	7.3e-43	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.48e-59	35	211	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA62469.1|CE5	7.24e-105	1	211	5	213
QMW26781.1|CE5	3.09e-92	6	211	8	212
BAE55151.1|CE5|3.1.1.74	3.09e-92	6	211	8	212
QMW38860.1|CE5	3.09e-92	6	211	8	212
QRD87059.1|CE5	3.09e-92	6	211	8	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	4.81e-91	15	211	1	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	2.29e-89	28	211	4	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	5.67e-88	15	211	1	198	Chain A, cutinase [Malbranchea cinnamomea]
3DCN_A	3.64e-60	27	211	11	200	Glomerella cingulata apo cutinase [Colletotrichum gloeosporioides],3DD5_A Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_B Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_C Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_D Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_E Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_F Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_G Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_H Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DEA_A Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides],3DEA_B Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides]
4OYY_A	7.74e-58	36	196	17	176	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XRY3|CUTI1_ASPFC	2.71e-150	1	211	1	211	Probable cutinase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_025250 PE=3 SV=1
sp|Q4X1N0|CUTI1_ASPFU	2.71e-150	1	211	1	211	Probable cutinase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_2G09380 PE=3 SV=1
sp|A1DGN0|CUTI1_NEOFI	1.02e-145	1	211	1	211	Probable cutinase 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_084890 PE=3 SV=1
sp|A1CSZ4|CUTI1_ASPCL	1.05e-122	1	211	1	211	Probable cutinase 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_081180 PE=3 SV=1
sp|Q5B2C1|CUTI1_EMENI	1.29e-105	1	211	5	213	Cutinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000291	0.999663	CS pos: 22-23. Pr: 0.7651

TMHMM  Annotations     

There is no transmembrane helices in Afu2g09380-T-p1.