CAZyme Information: Afu2g09350-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu2g09350-T-p1
• CAZy Family: GH1
• CAZyme Description: Glucan endo-1,6-beta-glucosidase B, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	Chr2_A_fumigatus_Af293|CGC28	44794.91	4.8506

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr2_A_fumigatus_Af293:2392804-2394050(+)

Full Sequence      

MIRRLAAFSALSGLATAWLPEVNKKITSTNGTNLFTSSNGKIRGVNLGSQFVFEPWIAEK
AWSDMGCGGQKSEFDCVSRLGQANANSAFASHWGSWITQDDIAEMVSYGLNTIRVPVGYW
MREDLVYSDSEHFPQGGLQYLENLCEWASDAGLYIIIDLHGAPGAQTPQNPFTGQYAPIA
GFYQDYQFEGALKFLEWMTTNIHQNDKFRNVGMLEVVNEPVQDAGKVGSMRSSYYPNAFK
RIRAAEQSLNIDRNNYLHIQMMDRLWGSGDPNESLTDTYYAAYDDHRYLKWASVAVSKDS
YISTSCSDQLNSNTPTIVGEWSLSVPDNVQWNSDWSPDSNKDFYKKWFAAQVTAYERQQG
WIFWTWKAQLGDYRWSYQGGLLLTRPGIGDQQVLTL

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	81	378	1.2e-148	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	6.76e-23	41	378	17	373	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.03e-12	90	368	13	270	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89699.1|GH5_15	4.61e-226	2	378	3	397
QKX60381.1|GH5_15	7.03e-207	2	378	1	389
QGA15346.1|GH5_15	4.71e-205	5	378	5	389
EAA59985.1|GH5_15|3.2.1.75	4.31e-203	5	378	5	388
ABF50867.1|GH5_15|3.2.1.75	4.31e-203	5	378	5	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	9.28e-35	39	393	6	382	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	3.41e-34	39	393	6	382	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	3.77e-34	39	393	12	388	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	7.10e-34	39	393	11	387	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PBO_A	9.98e-34	39	393	12	388	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4X1N4|EXGB_ASPFU	1.50e-308	1	396	1	396	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	2.50e-307	1	396	1	396	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	2.14e-284	1	378	1	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	1.05e-223	10	378	13	382	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|Q5B6Q3|EXGB_EMENI	7.66e-204	5	378	5	388	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000435	0.999553	CS pos: 17-18. Pr: 0.9672

TMHMM  Annotations     

There is no transmembrane helices in Afu2g09350-T-p1.