CAZyme Information: Afu2g02360-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu2g02360-T-p1
• CAZy Family: CE4
• CAZyme Description: Ortholog(s) have UDP-glucose:glycoprotein glucosyltransferase activity, calcium ion binding, mannose binding, misfolded protein binding activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1487	Chr2_A_fumigatus_Af293|CGC37	166570.02	4.8814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr2_A_fumigatus_Af293:591029-595713(-)

Full Sequence      

MAIGLGSVTSWRLCLVILAAFTPLVCGSPSVNVALQASFDSAPYLLELLETAAEENSTSY
FPLLDRIAEGTFDDATTEKQLYDRFLQVVYDDGHLSTPELLSSFKLSLAIRSAAPRITAH
YHFYNASVQHSLMAAQDAACPVWVHSEGKQYCSSSMERAQQDVMGESDPRELPFDRVLGD
LSLPPAVLYADIASPMFKDFHHTLSALAKDGQVSYRVRYRPPQHWISRPLFVSGYGVELA
LKRTDYIVIDDRDAEKRSQKDSGSSEWASVEEESPDDLGALSSSEVARLGLNTVSYVMDS
EEPLDTLVRISQDFPKHSAKIAAYNASDALLKDIRTSRLGMLPSGVNVMWINGVQIDPRQ
IDAFSLLDHLRRERKLIDKFRSIGLSAQEAVDLLCHQTLGETLAKDSPPRYNYRDQIEGG
GVIIWMNDLEKDTKYQSWPDDLSAYLQPMYPGQLPAVRRDAHNIVAPVDLTSSDDMELVV
KTLQVFVKRKIPVRFGLVPLASSPGSVAQLKVAHYLHETFGLASLIHYLEESAAKKKIGS
PDKAIFQHAIKDRTSRPNKQILSFDEILKSDELEILVSRTKQYQDRLGIKGNAPYILVNG
VFVPRDDNWPQEMSMRVGRDLQTIQQGVVDGSIEEDTWLPELFLSEAFDRRNPLIIPEDS
KDIRIVDISKLAKSRGDSADTLRIASEMDTLDSKHLIVVGDFDSENGLKLLVEALELRAT
HGEVEMVLIHNPAPDVETESGSALIYNALKGTDKVDASRVLRHLKTAENTNFPEAEAKKM
SQFWEAQQALARDLGFLPGTNGVIVNGRAIGPLPDGSTLSKEDLDGLLTYEEARRIGPVA
KAAKDLGLESKLSGPLALAELSSLAALSTVSDVPEGIFEQMSSIRMDLFKKWNDLLSVIT
VSTSEDPAIIIAASIDPTSETAQRWLPILKVLSRLAGVRVTLALNPRDQIQELPTKRFYR
YVLDSEPSFNDDGTLARPTATFSGVPVEALLTLGMDVPSPWLVAPKESIYDLDNIKLSSL
KPDANVDAIYALEHILIEGHSRDVTVKTAPRGVQLILGTEDNPHFADTIIMANLGYFQFK
AQPGLWKINLKPGRSQRIFNLDSVGGQGYSPQPGDENNEVALLSFQGKTLFPRLSRKKGQ
EMEDVLDTDVKSGSAMDYVSKGFNFAQGVLSSVGVGSKDGLAEKQADINIFSVASGHLYE
RMLNIMMVSVMRNTKHTVKFWFIEQFLSPSFKSFLPHLAREYGFSYEMVTYKWPHWLRAQ
REKQREIWGYKILFLDVLFPLSLDKVIFVDADQIVRTDMYDLVSLDLEGAPYGFTPMCDS
REEMEGFRFWKQGYWKNFLRGLPYHISALYVVDLNRFRALAAGDRLRGQYQMLSADPNSL
SNLDQDLPNHMQHHIPIKSLPQEWLWCETWCSDDSLSTARTIDLCNNPQTKEPKLDRARR
QVPEWTKYDDEIAALAERVALEQQRQQLEEMESADEDEESGWEKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1188	1435	1.5e-134	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1188	1455	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	0.0	1188	1435	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	2.14e-100	411	655	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	1.59e-63	41	228	1	185	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	5.26e-63	1038	1147	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65008.1|GT24|2.4.1.-	0.0	4	1487	4	1487
UDD64319.1|GT24	0.0	5	1487	5	1487
QRD91624.1|GT24	0.0	4	1487	4	1487
QMW47293.1|GT24	0.0	4	1487	4	1487
QMW35231.1|GT24	0.0	4	1487	4	1487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	22	1462	2	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	22	1462	2	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5Y7O_A	0.0	30	1153	5	1130	Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii],5Y7O_B Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii]
6TRT_A	0.0	22	1462	2	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	22	1462	2	1220	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	9.82e-289	18	1455	9	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	1.25e-243	27	1455	43	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	6.77e-243	15	1455	31	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.19e-240	15	1464	31	1532	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q09332|UGGG_DROME	2.95e-233	16	1459	12	1511	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999741	CS pos: 27-28. Pr: 0.9785

TMHMM  Annotations     

Start	End
13	35