CAZyme Information: Afu1g14140-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu1g14140-T-p1
• CAZy Family: AA7
• CAZyme Description: Has domain(s) with predicted dolichyl-phosphate-mannose-glycolipid alpha-mannosyltransferase activity and role in GPI anchor biosynthetic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		34858.71	9.4153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr1_A_fumigatus_Af293:3778222-3779227(-)

Full Sequence      

MASSSPSISLPMVSAFEPAVHWRTNNYPALQKTGAVDYAFREHVAGIIIAHAAHGLSVLV
LYCLGCAIFSGRKGRMLAFIAACLHIFSPAGLFLSAPYGESTYALLSFTGYFLFVQSFSP
SGASTSLKDALIPLAGILCGLATTVRSNGILNGLLFLEEAIRALYSLTGAITFAKFRRLL
AVGVAGICTALGFVVPQYIAYRDFCINYPFTGHDEPRIWCRRTLPSISSFVQDHYWNNGF
LRYWTVSNIPLFALASPMLAIMTYSALWTLNVESGRLTGAGRLLRSLAAPQLILAALTFS
KHHVQIITRMSSGYPVWYF

Enzyme Prediction     

No EC number prediction in Afu1g14140-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	36	318	6.9e-77	0.6609336609336609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.63e-24	44	319	120	389	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.01e-14	43	319	116	363	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAF32128.1|GT76	6.20e-163	1	236	316	551
BAE62404.1|GT76	4.32e-139	24	318	152	461
QRD83592.1|GT76	6.78e-139	30	318	107	410
QMW32162.1|GT76	6.78e-139	30	318	107	410
UDD57107.1|GT76	6.78e-139	30	318	107	410

PDB Hits     

Afu1g14140-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2GSI6|GPI18_CHAGB	5.36e-70	42	318	137	432	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	8.25e-70	44	318	113	385	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	1.13e-64	57	318	121	392	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	3.98e-64	42	318	107	382	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	8.92e-30	47	318	92	320	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999956	0.000046

TMHMM  Annotations     

Start	End
47	69
76	98
134	156
179	201
246	268