CAZyme Information: Afu1g06130-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu1g06130-T-p1
• CAZy Family: AA7
• CAZyme Description: Ortholog(s) have rhamnogalacturonan acetylesterase activity and role in pectin catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
683	Chr1_A_fumigatus_Af293|CGC6	75035.03	6.6213

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr1_A_fumigatus_Af293:1769637-1771787(-)

Full Sequence      

MTSLHFFNVVLSLLALFPVVLAQTCWRNTTCSGPKDSAFEGPWERGIYAPSSRTVRPKKV
LSITDLSLSSAYAQAMPATLHGNGSLVIFDFGIEVGGIVTLNYTSSGSGALGIAFTEAKN
WIGEWSDSSNGAFKGPDGALYANFTQAGKGSYTMPDEALRGGFRYMTVFLVTNESAKVQI
EDVSLEISFQPTWSNLRAYQGYFHSNDELLNRIWYSGAYTLQTNSVPVNTGRQVPMMHNG
WANNATLGPGDTIIVDGAKRDRAVWPGDMGIAVPSVFVSTGDLESVKNALQIMYNTQNTT
TGAFDESGPPLSQKNSDTYHMWTMIGTYNYVLFSNDTDFLLTNWEKYQAAMDFIYGKVDE
KSGLLIVTGTRDWARWQQGYNNSEAQMILYHTLKTGAQLAEWAESTHSLSHTWNTRAENL
KTAINQYCWDDAYGAFNDNATATSLHPQDANSMALLFGIVNETRAASISERLTDNWTPIG
AVAPELPKNISPFISSFEIQGHFAAGQPTRALELIRRSWGWYFNNPNGTESTVIEGYLAN
GTFGYRSSRGYSYDASYVSHAHGWSAGPTSALTNYIVGLSITSRGGLTWKIAPQFGDLKS
AEAGFTTLLGKYKASWKRNPKGYTLQFSVPQGTRGTLTLPYVTSLKKPSITIDGHDIKRG
LIYENETVTITMTGGGSHYVLVR

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	86	639	1.1e-97	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	8.31e-10	588	640	11	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	9.56e-08	201	474	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK57529.1|GH78	0.0	12	682	15	685
QRD88907.1|GH78	0.0	12	682	15	685
QMW37218.1|GH78	0.0	12	682	12	673
QMW25160.1|GH78	0.0	12	682	12	673
BAU45349.1|GH78|3.2.1.174	0.0	1	682	1	679

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.54e-19	44	607	158	667	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Afu1g06130-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999761	CS pos: 22-23. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in Afu1g06130-T-p1.