CAZyme Information: Afu1g04260-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu1g04260-T-p1
• CAZy Family: AA4
• CAZyme Description: endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
967		104033.50	5.9519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr1_A_fumigatus_Af293:1208618-1212183(+)

Full Sequence      

MCHESGFIQLFPYNNISVYVTFCIIVLRFFEVLRQLVLRYLSPRARQENGRGKHVALYSH
ADLAFSIRDSTIPTSFYPTSLEREGRSAEQPFPTDLNLGHLLDPLLHPQGGSEPGVLDLL
LSGLQPPTQPVPTKHLTTNPSVVTSSSPSKASTSKDTLPLISSPPVVSTASSSSTTANEE
STSQNTGSARPDYSSPDGTLSSSLEPAGKTSSSVESQTTSSATSGDPAQQNQSSTKPVTA
AATNMANGQDVFVPVSTGPIPKTIGSRNDHPVPKNGIVNTDTPVETNKFYCGLFLGTQTN
NTFTHPYSVAWVKGGGTSQSYGMAISHVESNIVAHGPVNTAIPGSPISYYVNPIGIHSVI
LSASELGPSTVLTTENPLPFSANAVLRPSASSSQSITIPVVQGMGFVTGIYSNLQPKIQS
GVFFTKMVTAGSPRTGIFKYSLSLKDGTSWLLYATPDDGSDPQLQLASNSEIIGPAGWSG
TIQVAKNPAGASGEKFYDNSSGVYAVEGAVMGSVSESTGTYSLMWAKAGKDAQNTPLLMF
ALPHHMESFDASTQSRATNITLRTTTKGQATAVIGEYWTMVEPELPISMGFAPWSVSGGS
IDKISPAAQQVILAAAPTELQQDMDAQTNLNSMYFSGKALSKFATLLYTVDKLGGNSTLA
AEGLARLKQSFARFIDNRQQFPLVYDNVWKGVVSSASYATGDVGADFGNTLYNDHHFHYG
YFIHAAAIIGSMDPQWLETSKDWVNMLVRDAGNSAGNDPLFPFSRGFDWFHGHSWAKGLF
ESFDGKDEESTSEDAMFAYALKMWGKTIGDVSMEARGNLMLGILRRSMRNYFLMESNNKN
HPANFIANKVTGILFENKVDHTTYFGNNLEYIQGIHMLPILPCSAFTRSKQFVKEEWDAM
FASNGPDPAENVVGGWKGVLYANLALVDPAASWNFFTQPNFDYSWIDGGASRTWYLAYAA
GLGAAPS

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	270	958	3e-232	0.9903536977491961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	0.0	603	954	1	347	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	0.0	201	954	4	747	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	5.74e-158	270	595	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAF13033.2|GH81|3.2.1.39	0.0	245	961	12	722
QRD82801.1|GH81	0.0	245	965	190	910
QMW28320.1|GH81	0.0	245	965	190	910
QMW40391.1|GH81	0.0	245	965	190	910
UDD56325.1|GH81	0.0	245	965	4	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBZ_A	1.73e-103	241	960	23	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K3A_A	2.60e-103	246	960	3	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K35_A	3.68e-100	246	933	3	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	6.76e-30	341	938	73	636	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	7.05e-19	634	879	361	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	210	961	161	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.98e-186	250	966	2	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.21e-164	270	962	66	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	2.37e-161	250	962	401	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	8.55e-156	250	961	427	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000005

TMHMM  Annotations     

Start	End
7	29