CAZyme Information: Afu1g01120-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: Afu1g01120-T-p1
• CAZy Family: AA11
• CAZyme Description: Pectate lyase F, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	Chr1_A_fumigatus_Af293|CGC21	24743.66	5.0280

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusAf293	10130	330879	290	9840

• Gene Location: location=Chr1_A_fumigatus_Af293:402756-403563(-)

Full Sequence      

MWSSIAAFPVLVPVALACLGYEGGVPTPTAHHSNSAVIEVAAGQVFDAGWAKYDRGSGAC
KGQSEGDWKDAVFYLHSGATLKNVIIGANQAEGVHCDGPCTLQFVWFEDVCEDAITIKND
KAGQETWIIGGGAYHASDKIVQHNGCGTVNIINFYAEDYGKVPRSCGNCDKQCKRNVYVE
GTTARNGGEVVGINLNYGDTATLKNVCADSAHPCVFYDGCAGDCEPKKVGYCSG

Enzyme Prediction     

EC	4.2.2.2:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	30	219	1.9e-88	0.9845360824742269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	1.92e-114	22	224	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46280.1|PL3_2	1.49e-156	1	234	1	234
QMW34226.1|PL3_2	1.49e-156	1	234	1	234
UDD63130.1|PL3_2	1.49e-156	1	234	1	234
QRD94021.1|PL3_2	5.08e-156	1	234	35	268
BCS26321.1|PL3_2	1.30e-143	1	234	1	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	4.31e-29	28	203	2	180	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	5.26e-20	38	186	14	155	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	5.37e-20	38	186	15	156	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	4.70e-19	38	186	23	164	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	4.70e-19	38	186	23	164	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WKV8|PLYF_ASPFU	3.17e-183	1	234	1	234	Probable pectate lyase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyF PE=3 SV=1
sp|B0Y953|PLYF_ASPFC	1.06e-181	1	234	1	234	Probable pectate lyase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyF PE=3 SV=1
sp|A1D5E3|PLYF_NEOFI	3.84e-175	1	234	1	234	Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyF PE=3 SV=1
sp|B8NJZ7|PLYF_ASPFN	2.65e-157	1	234	1	234	Probable pectate lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyF PE=3 SV=2
sp|Q0CCF8|PLYF_ASPTN	8.86e-156	1	234	1	234	Probable pectate lyase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000373	0.999600	CS pos: 17-18. Pr: 0.9649

TMHMM  Annotations     

There is no transmembrane helices in Afu1g01120-T-p1.