CAZyme Information: AYO44873.1

Basic Information

• Species: Malassezia restricta
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia restricta
• CAZyme ID: AYO44873.1
• CAZy Family: GT57
• CAZyme Description: UDP-glycosyltransferase 84A2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566	CP033155|CGC3	63607.36	6.8526

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MrestrictaCBS7877	4155	425264	59	4096

• Gene Location: location=CP033155:309831-311531(-)

Full Sequence      

MSSLVLTPKRYLILTNPATGQVNPLLSIAEELVNRGNQVVFMSSEPIFKKLKKIQSRMGF
IVQPESTPSPEYVMRMPLVFYTLGDNEVVADYTDKAAKLSDHFHEVLRSKPGQIWAWLSM
FAEHVPGATDSYGEVVFMIRDLIESLDPDMIIVDNFSAFAVDGVRLTKRAFIETSPAAAS
AVASKVNIFRNPMPMSGGRSATGGIFVFFHNLLFILIWLHFIFFNRHPAQRRRYRKEVLG
LKPTDIICDSIMTPTPGMLPQQIATISFNVANMDIYPSDAYDNSVYFVGPCFAPKQLTMP
SARSIPSSPVNFSFRNLELSPNVSTASTPTIADGSMLEKQMLSAHAVAQMQDPVKIWMDR
AMMDSKRVLYLNMGSIFFYNREDYDNIVASLEMLHEQVPDILVLWKIGNHPQSVQPIPTL
EECNLPSYIRREHWIADVETVLSHPALAAFMHHGGGNSYNEALAHGVPQFCISQWVDTHD
IGLYIQHSGVGLWAEKSPKFDPSDMVPKLVRLLKDDYKRFRHSALSWKLKCIQAGGTIGT
VDIIENLLKSYDFPDNNSKARIPDAI

Enzyme Prediction     

No EC number prediction in AYO44873.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	365	548	7.8e-19	0.39790575916230364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.28e-21	10	519	2	379	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
178170	PLN02555	1.08e-07	363	477	271	386	limonoid glucosyltransferase
177830	PLN02173	2.59e-07	357	537	257	434	UDP-glucosyl transferase family protein
177813	PLN02152	4.05e-07	306	542	198	444	indole-3-acetate beta-glucosyltransferase
273616	MGT	7.93e-06	364	549	223	391	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYO44873.1|GT1	0.0	1	566	1	566
SHO78186.1|GT1	9.41e-263	9	566	9	563
AXA52113.1|GT1	5.58e-195	299	566	1	268
AYO45013.1|GT1	1.25e-164	9	566	5	516
AXA52354.1|GT1	1.78e-164	9	566	5	516

PDB Hits     

AYO44873.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M9MH90|EMT1_PSEA3	8.79e-42	13	545	5	560	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	1.60e-41	13	545	5	559	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	6.94e-14	352	511	269	436	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	3.40e-10	357	496	294	434	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|O23402|U84A4_ARATH	3.20e-06	357	485	269	389	UDP-glycosyltransferase 84A4 OS=Arabidopsis thaliana OX=3702 GN=UGT84A4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

Start	End
202	224