CAZyme Information: AYO44370.1

Basic Information

• Species: Malassezia restricta
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia restricta
• CAZyme ID: AYO44370.1
• CAZy Family: GT32
• CAZyme Description: Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1081		120927.24	6.8962

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MrestrictaCBS7877	4155	425264	59	4096

• Gene Location: location=CP033153:517235-520480(-)

Full Sequence      

MPDAQSRRRVLIAAYLLPKTIEFQSDEAHEADESAIERTYSPPTQHGTSHTEQLAHQLTS
SLMEAIDKEQARSRVLAGRPGRVSTAMSSSPRQALSAPRERVNMAELMADAAAGTKPSYL
QRSSSSITSYEVDMEQRHSDNAPQAVKSSLSDHGRRASTQGELGTSQATPPRSLPPPVSS
ASSTSPLPIPISIISDLEAKSHQGTATAPTPKENPYGLGSSTPVPPVRSSAVSSSTTPRL
MEHPHLAPGWTDGIEAIHTSSTPNAAPPPRGPTPASTEGAVRDEERRTSTVWRFNIARPA
LRSRSKRFSSSQQRIPFEFLPNPGANHGLFNAVNSAGTQVASRSVYVGTLGIEMDWLSTH
MRAEIDAKAMDQHKCVPVWLKDDEYVHCYHHYCKQILWPAFHYTQPSAQALETEHDAFHA
YVKVNQSFADRIVAEYREGDVIWIHDYHLLLVPAMVRAVLPRAPIGLFVHIAFPSSEIFR
CLSRREELLRGMLGADLIGFQTHNFFQHFRQTVSRILQLPTTSRGIVLQRSFVTVAPFPI
GIDVRVLNQRRQHPDVREWVAKLKERFAGMRVIVGRDKLDWIKGVREKLLAFELFLDQHP
EWVGRVVLVQVALATVQENHEVGDVSDIVSRINRKHSSLTYQPVVFLHVNEITFSQYLAL
LTMADAFVATSLREGMNLTSHEYVIAQEERKRPLILSEFTGAYSALRACIGINPFHAQQV
AQAIERALTMDEDEMAQRWTDLHRTVVSQTAEHWVLSVLSQLERAHLSQPSPNTMFTPRL
EIGQMQAEWRVAGTRLVLLSLEHTLVWEDAKQLHEHGFEPPAELVGVLRRLTADPRNYVY
VLSRKSTTDLDQLARAVPALGIIAENGCYAQHCTRAPDGACEWMSLVDGIDMKWREPVRN
ILDYFTERTPGAWIEERSTTITWYFCEGTTNQQDVAWARRQASEVQSLITDSLGERFSLR
MINENTHFVIMPKNVGFTPAVQYMLALDNMGSLPVRQGTPGKALFEFVLYIGHDEKLLSH
LNHVDLPFAPRTCTTARPDTIAGSIASCQLEPGKQVLDALEEIVDVHLRDLKWGGPAMMD
V

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	324	764	1.5e-151	0.9221052631578948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	317	763	21	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	2.16e-170	316	764	23	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	3.02e-165	317	925	21	612	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	1.08e-142	376	771	88	486	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215555	PLN03063	6.91e-130	335	942	37	644	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYO44370.1|GT20	0.0	1	1081	1	1081
AXA51612.1|GT20	0.0	1	1081	1	1081
SHO78042.1|GT20	0.0	2	1081	6	1105
ASM58230.1|GT20	2.85e-277	316	1074	488	1313
CBQ71131.1|GT20	8.13e-273	316	1075	497	1335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	4.03e-93	377	764	73	464	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	1.69e-91	365	764	73	476	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	5.50e-87	365	762	72	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5DXF_A	9.54e-87	344	762	101	523	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HUV_A	4.88e-84	328	766	33	471	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14081|TPSX_SCHPO	1.94e-129	282	944	156	835	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q9UUI7|TPSY_SCHPO	2.02e-129	326	985	172	824	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|P38426|TPS3_YEAST	1.15e-114	283	1016	272	983	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|P38427|TSL1_YEAST	3.47e-112	301	995	334	997	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	4.32e-108	326	925	33	624	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AYO44370.1.