CAZyme Information: AYO42482.1

Basic Information

• Species: Malassezia restricta
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia restricta
• CAZyme ID: AYO42482.1
• CAZy Family: GH5
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1479	CP033150|CGC7	167746.84	5.7884

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MrestrictaCBS7877	4155	425264	59	4096

• Gene Location: location=CP033150:58593-63032(-)

Full Sequence      

MMEAAGQVWPHAFFSLVSRIWSHPSAGGELKDMSYERLYHHMEGVLRSLAVDVHDAYPES
HLEEWRTLVAQHAQAAKVESYYQMFEAGSNLRSLNVPCDTFVHVNGHAYCSLPAARQAIQ
ALNTSSPLLAHDHVHPSHTAPGPSLVLYADPYSTSIHEFHDMLHALSSTSHVKYVFRWRP
SVASVKSRPMSRYFSGFGTTMHLKKVDYLVLDDRHIDKSHHAELPMSHEPDRVRIFSDQL
QNKLHRLLGTKRPSVQDAVTRHSNLTISELAQLDVAATHAILSSDDPMSTWESIVLDFPI
HSGTLSDYMDTIPDDDTILDTLNNVEKRLISPGITQLWINGLPVPVTELQPLSFIKRMHD
ELDLIEAFGASELGISPDGAEMIMANPSVNAAFAPIQAAPQFYDASDALESSSELGMPVI
AWVNDLTNSMYADWPKTLKDMMRYRWMSGLPLIQQNFFQLVVLLDMRDPRALLLLGMYLD
ATLMDYAIRWGIVPLLEDEDCHVLAQLLWLGMEQLAALEIPLFLQKLAATPLTPEGRVDP
KQARAVLRSMLPASAQEDNELMAFLNGGERISGYKRLLELAKSYLGRLHTMKRPGSSGVA
YFNGQEVSLDEHLISQVFAATKYQLQMAWDDIRDGYIDSQDRYTRYFYDLRDTKSRRSAL
VTMVEDAQSFVRPSVYVRLPDVTRELGEHARPIRDFLYSPGDTSVSIRLLGDLNDRATLD
ILLRALEAMETTPFRLSFVHTGTSDGLLSEWLLQAMHAGALSNMSHNDLYHALESNNLAA
SLENLRQKYHIPTTKYSWSQISLAFSQALELKHVGPIILLNGQSLDHIQGVSQFDIESVV
AWEDEVHVQALLNALDVPDETRESRAQVIEFAVSVVGWNFAKNSDQEGPMESAPQKRDPS
GMYLHNSDLMLRMGQDSAPIHITGLLDPLCTNAPQLVSLLRMMSTFSCVRISLMLNPRIR
VPSLPFNQFTRFDYRTQPRFDEHGQEDMPSLSFESLPESSVLTMQIHAPRSLVAMADEAV
YDLDNIRLADVHGRLDTVYSVNSILVEGHARAEHGPIPEGLQLVLSSDDQRSQLDTIVME
NLGYFQFRAQPGRWTLRIREGRSQDLYEMTSVGALGWSSPPVSHTGAAITLDTLEGVTIF
PTFRKHKGKEMEELISSVDMAESLTTSKFSSLLHQAVSYVGQLLRPMRSKGKHAEINVFT
LASGHLYERMTYIMILSVLRHTKSSVKFWFVENFLSPSFKSFIPHLAQAYHFDYELITYA
WPEWLREQTEKQRMIWAYKILFLDVLFPLDLDRVIFVDADQIVRTDLKQLVDMDLHGAPY
AYPPMGDDSEDMDGYRFWKQGYWKNVLRGHPYHISALYVVDLKRFRSIAAGNILRVHYQQ
LTADKNSLANLDQDLPNNLQPLLPIHTLDKTWLWCETWCSHDWLPQAKTIDLCSNPKTKE
PKLDRARRQIPEWTELDNEVAAFAESLRSPSYSTPHDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1196	1443	5e-123	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1196	1463	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	1.20e-159	1196	1443	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	8.55e-54	1196	1437	1	242	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
399437	UDP-g_GGTase	3.37e-46	1047	1156	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.
408201	Thioredoxin_14	1.12e-29	403	661	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYO42482.1|GT24	0.0	1	1479	1	1479
AXA50352.1|GT24	0.0	1	1479	49	1527
SHO77403.1|GT24	0.0	1	1479	49	1530
SAM79866.1|GT24	2.45e-272	1	1467	58	1634
CDR87171.1|GT24	2.61e-259	1	1467	58	1626

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	5.58e-184	1	1468	28	1452	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	5.63e-183	1	1468	28	1452	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	2.94e-182	1	1468	28	1452	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	3.68e-163	699	1468	441	1218	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	7.67e-151	1	1405	21	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.00e-186	89	1471	112	1432	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	4.25e-157	66	1477	103	1521	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q0WL80|UGGG_ARATH	9.14e-142	111	1467	165	1572	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q9NYU1|UGGG2_HUMAN	3.22e-139	98	1479	135	1516	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	3.55e-137	98	1460	147	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AYO42482.1.