CAZyme Information: AYO41915.1

Basic Information

• Species: Malassezia restricta
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia restricta
• CAZyme ID: AYO41915.1
• CAZy Family: GH16
• CAZyme Description: putative glycosidase crf2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640	CP033149|CGC4	70342.92	6.8073

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MrestrictaCBS7877	4155	425264	59	4096

• Gene Location: location=CP033149:366294-368216(+)

Full Sequence      

MRLAILGLLLAAIEVLAGKERCGPNKPSCPSDKPCCSADGYCGGGAEQCTSGCQPQYSQY
PFSCIPNSVCEDMDLAIKPDMYNQDNYFRPLLRYNGDASQTAFVFEQGYLGQGHNGVLFE
KTSATDSRVSTARYLLYGTVTARLRHNPTSGLVTTFGTASDVGDAILFRLAGPESGRITT
NYAAHGQSAQNIGTQKRMDKFTVANFHNYTIDWSPHHITWKVDHQVIRTVSRKDAGDKFP
RTPSRVLFTAYGVSESSNKNMKNWANGTLSFDDDGYRSRGFYSHELAHLRIQCADHKLAN
ISQTGVGSEPVAYVYSKKNHSQTQPLDFSLSTDQVSLLKNPAKDGRPGTPGKPGTGPNGD
RPNMYTGGSGRSTKKNSDDDDDDTSTTSNGVKIGIPVGIGGAALLGALALLIFYFVRRQK
RALRRPASLVSVQEPMQMRDTSASFGTPIAGEPTHHIAVPVSMQPQRGEQPFDLQQSIAV
PQEEHAIDRMPEAQGVAPSDDSINEAALYYQDPYGAEMSYEVESDMGSQASDDKAHRMHY
AEHGDMRRYYPYLSEEENERIAAQDAWDELREAANGRTEVPYFKSANTSSTNPRRDSDLF
LTRHRRGQDSTYRARRVHQRAAYSEGGALSPSLPDTPSFS

Enzyme Prediction     

No EC number prediction in AYO41915.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	118	269	1.8e-33	0.9080459770114943

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	3.84e-34	94	295	3	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	9.22e-25	115	265	11	167	Glycosyl hydrolases family 16.
211314	ChtBD1_GH16	5.47e-11	21	67	2	46	Hevein or Type 1 chitin binding domain subfamily that co-occurs with family 16 glycosyl hydrolases. This subfamily includes Saccharomyces cerevisiae Utr2p, also known as Crh2p, which participates in the cross-linking of chitin to beta(1-3)- and beta(1-6) glucan in the cell wall, and S. cerevisiae Crr1p, a putative transglycosidase which is needed for proper spore wall assembly. ChtBD1 is a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
185683	Glyco_hydrolase_16	3.93e-09	130	251	60	184	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
211311	ChtBD1	4.03e-09	21	56	1	37	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYO41915.1|CBM18|GH16	0.0	1	640	1	640
AXA49093.1|CBM18|GH16	0.0	1	640	1	640
SHO79225.1|CBM18|GH16	1.75e-152	1	640	1	592
SJX60964.1|CBM18|GH16_19	1.55e-58	46	347	61	364
CBQ70290.1|CBM18|GH16_19	4.39e-58	46	347	61	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	5.17e-14	108	295	40	225	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	1.41e-25	49	295	52	302	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q05790|CRR1_YEAST	6.59e-17	115	322	167	382	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|P32623|CRH2_YEAST	4.86e-16	47	337	50	337	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3
sp|D4B4J2|CRH12_ARTBC	1.40e-13	134	276	94	239	Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03382 PE=3 SV=2
sp|Q8J0P4|CRF1_ASPFU	1.30e-12	108	295	61	246	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999753	CS pos: 17-18. Pr: 0.9786

TMHMM  Annotations     

Start	End
393	415