CAZyme Information: AYO41394.1

Basic Information

• Species: Malassezia restricta
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia restricta
• CAZyme ID: AYO41394.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876		95296.98	6.8181

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MrestrictaCBS7877	4155	425264	59	4096

• Gene Location: location=CP033148:807330-809960(+)

Full Sequence      

MAMLNTVGSVLASGKNESFKLQYRVVAQDSLASAMMLGLANEDTAFIFDKVENNKKKTAS
GRPTWASLVQLSDYSVRGIDATTNPFCAAGTTLGNGSYIVAGGNSAISYGGINVKNSDGS
MNLNGPAPPYNDMDGRRVVRMMQPNADSSKLKWIDDFDSPNQMDSPRWYPAIEGLADGSV
VMIGGATSGGFINRNYPNVDPVYATSSSNPKAGVWDQGGANPSYEFWPRDNKPKPAVHDF
MVKTSGLNMYAHTYLLPSGRIFMQANYSTTIWDWTKDKFHDLPDMPDRIVRVYPASGATA
MLPLTPKNKYTPTILFCGGFNNATDEEWGDFTAPRVNMFERAGSDDCSSITPEDADGRIK
KNVGYVREEKLPEPRSMGQFIHLPTGQMVIVNGASRGVAGYGNTTWNTVKDMNGNTVHLE
GMSQMPTYRPVLYDPERPQGKRLEYANYGSSKIARLYHSSAILVPDGSVLVAGSNPHMDV
SYLPPNDQLDTKYEAFNTTYALEQWYPSYYFERRPEPMGMPEVIKYGGDSFNITVDAHYM
NPNKNANAMANNTKIMVIRPGFSTHAVNFGQRSLQLENSYVVNKNGSVTFIVNPMPSNMN
IFVPGPALLFVTVNGIPSKGKYVFLGGKDLGSVPFDLKAGFTPAPLPDPVLNPHFTNEAA
PYGTTYDSDEQNGMSGGAIAGTVIGVILGVAVLAGLAFYVWRAKRNDDNEANYAAVRHPH
ASHGSQMTGPEANAGAWTRPPPLSDSSKFPLMQPNDSAISLSDASAVTPLSSDVHKTHPL
SITGSHPASASTSGASAERYNMFFAAQDSGIMTPVNSQGSHLYHNMPSSSRGPILMPEQP
HWNDIPRQLHGPRSMPRSNLQQHLSMAREGSMPSHQ

Enzyme Prediction     

EC	1.2.3.15:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	20	639	3.3e-232	0.9733570159857904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401164	DUF1929	7.18e-23	521	623	3	89	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	4.01e-21	509	625	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
399910	Glyoxal_oxid_N	1.19e-18	83	319	65	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
214014	TM_EphA1	0.009	673	705	7	37	Transmembrane domain of Ephrin Receptor A1 Protein Tyrosine Kinase. Ephrin receptors (EphRs) comprise the largest subfamily of receptor PTKs, and are classified into two classes (EphA and EphB), corresponding to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EphB receptors, which display promiscuous ligand interactions within each class. EphA1 has been associated with late-onset Alzheimer's disease and certain cancers such as colorectal and gastric carcinomas. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a single-span transmembrane (TM) domain, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored to the plasma membrane. This allows ephrin/EphR dimers to form, leading to the activation of the intracellular tyr kinase domain. The resulting downstream signals occur bidirectionally in both EphR-expressing cells (forward signaling) and ephrin-expressing cells (reverse signaling). The main effect of ephrin/EphR interaction is cell-cell repulsion or adhesion. Ephrin/EphR signaling is important in neural development and plasticity, cell morphogenesis and proliferation, cell-fate determination, embryonic development, tissue patterning, and angiogenesis. The TM domain mediates dimerization.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYO41394.1|AA5_1	0.0	1	876	1	876
AXA48404.1|AA5_1	0.0	1	876	10	885
SHO78428.1|AA5_1	0.0	2	873	12	900
CDU24204.1|AA5_1	3.32e-227	23	729	41	717
SJX66177.1|AA5_1	9.73e-227	23	729	41	717

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	2.99e-14	163	623	253	612	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
5LXZ_B	1.41e-12	163	623	242	601	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	1.42e-12	163	623	247	606	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]
2EIC_A	6.03e-07	147	618	254	630	Chain A, Galactose oxidase [Fusarium graminearum]
2EID_A	6.03e-07	147	618	254	630	Chain A, Galactose oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01772|GLOX_PHACH	1.38e-60	39	626	44	550	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	3.17e-34	167	625	197	593	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	3.60e-33	68	625	78	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	9.27e-33	65	623	155	612	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|D4AUF1|WSCD1_ARTBC	4.74e-26	55	627	446	905	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000001

TMHMM  Annotations     

Start	End
679	701