CAZyme Information: AWU78226.1

Basic Information

• Species: Pichia kudriavzevii
• Lineage: Ascomycota; Saccharomycetes; ; Pichiaceae; Pichia; Pichia kudriavzevii
• CAZyme ID: AWU78226.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1423	CP028777|CGC1	165199.07	4.6966

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PkudriavzeviiCBS573	5367	N/A	212	5155

• Gene Location: location=CP028777:596950-601221(-)

Full Sequence      

MILGDFATFSLALLSIIGACVAETEIPPKNAVDISLAASWNRTPYKLNVLEAAASVNESL
YEPLVLKLLNIEPDYDNGEFNADEDYIEVSDSDFLNHAMSLLHGDYEKYMFNLQLSNHLS
TARINAHFQYYNTSVKDTHECDVDAVLFEPLGPSPQHYCDPDAAFMLQNANYAFIFDTFK
LPFDRRLGSTFTPSSYIIYGDYRDETFRKMFLNMYQFAGTGKLNLVWRYVNTHPDNRPEL
LAGYGAALNLKKTDYIAIDDSGFTQEQESKLLELGSNNKDETVNITDIYRHNFEKVQKVD
LEDLSTIGLKFTKLISESKSQFKDLMTILAEFPKYARTISKIGYSEDELKAVAGVADEDY
GKFVENGIYINDALVPVEKTDLFEIFRAIKREVSFIKLLQAIDIHYDDARTLMSRFAQMI
SPYFASTKRRFNFSRYDDLVVYLNNIEEDYKYSLFDSTIDAYIKKPDVNELPRAKENIHQ
MIFIIDLTDLEKLENLISFLRTMFIEAFPIQFGVVPLSTSNELNEKITSQLYSAYAEDGR
EGAFKYLITLRSSLAGENHHPPDNFSQLEEPLLKERLEKLGLFYKNFGIDHEMPTIFSNG
VVFGFHKVVDALNNVFDDMLYLYDMKSQIGEGETYSEFLRKDSVHSKDTNIVPERISQIK
GNFIKPPSIIASKHWFSTDRLIIEKPIIPGQAPITINLLGSFFNTEYIRQVEEVLRYSQT
NEGIKIVISDVTPTKDFKKLLQLQTVEEKISFLSTLVESDTEDNYKIRDYVRFCKEMFGL
NFEKEYLNAYIVVAGRKVQIKNFMDVHSIESLVHYECASRLNVLKELENEFDYNVPFKNE
YDRFQHFAWVVSYTYFFPAPEPYSASNIPRFHRYKFSEENTIIKQAKDELIEVDILIDPV
SEYAQELVSFIPLFEKESFITLKVHLRPKRSVDILPINRFYKELVNTDVNQVSEKIRFEK
VPEKTLFNVELHETQRWLVSINNASTDLDNLMLDLTDSKSAFGEFLLENILVEGYTSNDA
TGLPLEISGPSKYETTVLANTYFQLKANPGTWTIKIKDYTKGSLVYMMTEEVKTISVIEL
DGTIIDLDVQKRWLMESISLVNPLNETGVKAFSEKMYAYFFETMDFIYSFIKPTQADINI
FSIASGHLYERFLGVMVSSVMKNTNSSVKFWFIENYMSPDFKKKLPLLSEKYGFDYELIM
YKWPVWLDSQRERQRTIWGYKILFLDLLFPQDLKKVIYVDADQIVRADLKELVDIDLEGA
PYGYVPMCDSKKEMESFRFWKTGYWKEFLGLKYKYHISALYVVDLEKLREVAGGNILRQQ
YQYLSKDPESLSNLDQDLPNLLQPHLKIYSLSQEWLWCETWCSNDTLKDAKTIDLCNNPQ
TKEPKLNRAKRQIQEWVELDQENMILFSGSTEVLKEDLEHDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1138	1386	1.6e-121	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1138	1402	1	264	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	3.24e-151	1138	1386	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	3.44e-53	1138	1386	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	3.12e-25	43	230	2	177	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408201	Thioredoxin_14	7.88e-23	440	607	13	198	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWU78226.1|GT24	0.0	1	1423	1	1423
QPG73382.1|GT24	1.65e-299	29	1423	4	1461
QOU21387.1|GT24	2.26e-279	19	1416	17	1471
ANZ77159.1|GT24	5.66e-264	32	1423	23	1452
AOA68779.1|GT24	1.14e-258	32	1423	23	1450

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NV4_A	1.12e-162	25	1402	4	1443	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	1.55e-162	25	1402	4	1443	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	2.98e-162	25	1402	4	1443	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	2.10e-137	25	1402	4	1209	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	3.10e-129	31	1343	3	1377	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	3.08e-158	9	1421	5	1440	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9JLA3|UGGG1_RAT	3.29e-141	184	1402	183	1519	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	4.22e-140	197	1402	197	1519	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q0WL80|UGGG_ARATH	2.24e-137	11	1422	13	1581	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q09332|UGGG_DROME	4.41e-137	38	1408	36	1509	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000545	0.999431	CS pos: 22-23. Pr: 0.9679

TMHMM  Annotations     

There is no transmembrane helices in AWU78226.1.