CAZyme Information: AWU75619.1

Basic Information

• Species: Pichia kudriavzevii
• Lineage: Ascomycota; Saccharomycetes; ; Pichiaceae; Pichia; Pichia kudriavzevii
• CAZyme ID: AWU75619.1
• CAZy Family: GH81
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	CP028774|CGC7	47421.85	7.3426

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PkudriavzeviiCBS573	5367	N/A	212	5155

• Gene Location: location=CP028774:1843242-1844471(-)

Full Sequence      

MDYVNIPDKTSPSLIHRLSNHVSKNRLKVITLFACLIVVYSQCFNGLSTYNARRMQNSSM
DTYNMKTTYDDLHIKYNKLPTNASLRAQLSYYFPYDTNSKIPQSIFQTWKSKPGDSNFPM
DFLGTVSSWEKNEGYAHTIFTDNVLDDWVHTEFSNVPDLVRAWDLLPKIILKADFFRYLV
IYARGGIYSDMDTFCLKNIHDWAPFNERYTKGEQIGFVIGIEADPDRPDWAEWYARRIQF
AQWTIMGKRGHPFLRELISRIVEETLRKEHMGYIKHVEGKDSGSDIMQWTGPGIYTDTMF
DYLNNILSDGDYGSGFGIGSKYWNDGEKYKLKHQEVNKEGLPLHFKDMVVNYKAFTGLRE
PKVIDDVMVLPITSFSPGVGQMGSRSPRDPMAFVQHIFHGSWKDDKKKD

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	125	203	6.2e-21	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.24e-38	83	405	64	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.14e-15	119	209	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWU75619.1|GT32	0.0	1	409	1	409
BAE94371.1|GT32	2.41e-149	8	408	9	433
AAS77488.1|GT32	4.87e-145	3	407	4	428
QPG76756.1|GT32	1.51e-138	1	403	1	430
CAY67315.1|GT32|2.4.1.257	1.63e-119	84	404	76	404

PDB Hits     

AWU75619.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.58e-112	12	405	7	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	6.02e-87	84	408	79	475	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.64e-72	90	405	131	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.64e-62	80	407	109	392	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	8.15e-08	98	199	54	149	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000005

TMHMM  Annotations     

Start	End
29	51