CAZyme Information: AWU75593.1

Basic Information

• Species: Pichia kudriavzevii
• Lineage: Ascomycota; Saccharomycetes; ; Pichiaceae; Pichia; Pichia kudriavzevii
• CAZyme ID: AWU75593.1
• CAZy Family: GH72|CBM43
• CAZyme Description: Dolichyl-phosphate-mannose--protein mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A099P2M9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
739	CP028774|CGC1	85340.71	7.5305

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PkudriavzeviiCBS573	5367	N/A	212	5155

• Gene Location: location=CP028774:1789937-1792156(+)

Full Sequence      

MAPKSKKSTVPVSQLAAKVETPEVIAKDSHMEKWYRLANFTVTFVAFVARFYYIWFPSEV
VFDEVHFGKFASYYLERTYFFDLHPPFAKMLIAAVGWLVGFDGKFKFENIGDSYIEHSVP
YIPLRALSAILGTLTVTLMFETLKQCNYSIWTCILGSAIVALDNAHVGETRLILLDATLI
ISVAASMYTYVRFTKLRRTPFTFEWYKWLFLSGVSLSFVISTKYVGVMTFLSVGVAVAYE
LWYLLDYRTGLTIREFARHFVARFMLLIVVPFIIYLGWFYIHFAILTKSGPGDAFMSTEF
QETLGDSILAKEAKDINYYDIITIKHKDTDCLLHSHPYRYPLRYDDGRISSQGQQVTCLN
HGGEDEGDHWEILPATPFEGNKLGHPVYQGDTFRLRHIKTNGYLLTHDVASPLYPTNEEF
TVVSLEEGDGPRYQDTLFKFDPVDQKPHEVMKTKGSIIKILHVPTVVAMWTHNDVLLPDW
AFNHQEVNGNKNINSKENNWYVDQIIGLSGPRAIFTPKPIKKLSFFRKWWELQFLMFEHN
NNLSSEHPYASQPGAWPLCMSGVSFWTKNETRQQIFFVGNIPGWWYECLMMIAFLAVAAF
DQLTVHRNIHILTEKTRTRLYNNVGFFFIAWALHYFPFFLMGRQKFLHHYLPAHLLAGLF
AAGFTEILFTNCRNQQWCQKGEKPDTLNTLPYISFVVLVLAVFVSGFIFFAPITYGNVPL
SVEEVLSRQWMDIKLHFGK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	42	283	9.1e-64	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	42	732	30	691	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	5.56e-77	41	287	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	9.82e-60	527	732	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	4.65e-13	325	482	4	163	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	7.84e-11	315	375	3	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWU75593.1|GT39	0.0	1	739	1	739
QPG73606.1|GT39	0.0	19	739	26	757
QOU20299.1|GT39	0.0	11	739	31	758
CCA36946.1|GT39	1.70e-306	27	739	20	741
CBF14025.1|GT39	1.70e-306	27	739	20	741

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	4.34e-92	48	732	62	725	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	9.20e-75	43	716	72	734	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
3MAL_A	2.54e-07	311	413	13	106	Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana],3MAL_B Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	5.55e-289	25	739	37	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	2.50e-284	42	739	59	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	6.51e-216	33	732	56	768	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|O74189|PMT1_CANAL	4.23e-103	21	721	52	739	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT1 PE=2 SV=1
sp|P33775|PMT1_YEAST	2.23e-91	48	732	62	725	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000000	0.000013

TMHMM  Annotations     

Start	End
34	56
79	101
121	143
172	194
201	220
224	243
264	286
581	600
620	642
647	669
690	712